KEGG   Naumovozyma dairenensis: NDAI_0J00980Help
Entry
NDAI_0J00980      CDS       T02234                                 

Gene name
NDAI0J00980
Definition
hypothetical protein
Orthology
K00866  
choline kinase [EC:2.7.1.32]
Organism
ndi  Naumovozyma dairenensis
Pathway
Glycerophospholipid metabolism
Metabolic pathways
Module
Phosphatidylcholine (PC) biosynthesis, choline => PC
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    NDAI_0J00980 (NDAI0J00980)
Enzymes [BR:ndi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.32  choline kinase
     NDAI_0J00980 (NDAI0J00980)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:complement(224656..225969)
Genome map
AA seq 437 aa AA seqDB search
MDNANTTINDTTKIPFVNETIDIATTSDLREHILHLIHRLQIPNWYGTIASTEQFQIYKL
KGALTNVIYRLESPLLLSDDVTTIPSLLLRIYGDQDDSSVDREYELKSLQKLHDVGMRGP
IILGIFNNGRIESFFDGFHSLEREEIRDMSISRSIAMALKELHVKIQLDGESVRGQPDCW
LKINKWIHTIGRQLEQFSMGNDVVEKLLLCPKWEFFNTSIHKYREWLQKQESKYEGGSLP
LLHLKFCHNDLQQGNILHNYRKRQETNKDDVILIDYEYAGPNPISFDISNHLTEWVHDYN
NQEDPAKCVGEKYPTTLELQNFLSTYLNHLSSTTNDDNDADLVRLHNSIIRWRPCTQLFW
SVWAILQGGALLVDKNAHTQGHSDDGDKFDYNRFCQEKMSYFWGDLIKFGIVNKNDLEKY
DIRYIESEFLPETYIKS
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atggataatgcaaatacaaccatcaatgatacaacgaaaataccatttgtgaacgagaca
atcgatatagcgacgacaagcgatctccgagaacatatccttcatttaatccacagacta
cagattcccaattggtacggtactatagcctccactgagcaattccaaatttataaattg
aaaggagcattaacgaatgtaatttatagattggaatcgccgctcctcttgtccgatgat
gtaactactataccttctcttctattaagaatatatggtgatcaagatgattctagcgtt
gatagagaatatgaattgaagagtttgcaaaaattacatgatgtagggatgagaggccct
attattttaggaatctttaataatgggaggattgaatcattttttgatgggttccatagt
ttggaaagagaagagattcgtgatatgagtatatcacgaagtattgctatggctttaaaa
gaattacatgttaagattcaactggatggggaaagcgtgagggggcaacctgattgttgg
ttgaaaattaataaatggattcatactattggaagacaattggaacaatttagtatgggt
aatgatgttgtggaaaagctactactttgtcctaaatgggagtttttcaatacgagtatt
cataaatatcgggagtggctacaaaaacaagagagtaaatacgagggaggatcacttccg
ttattacatttgaaattttgtcataacgatttacaacaggggaatatattacataactac
cgtaaaagacaagaaacgaataaagacgatgtgatcttaattgattatgaatatgctgga
ccgaatccaatttcgtttgatatatcaaatcatttgaccgagtgggttcatgattataat
aatcaagaagatccagcaaaatgtgtaggtgagaaatatcctactacgctagaattacag
aattttctgtcaacatatctaaatcacctgtcatcaacaacaaatgatgataatgatgct
gacttggtgaggttacataattcaattattagatggagaccatgcactcaattattttgg
tctgtttgggcaatccttcaaggtggtgcattattagtagataaaaatgcacatacacag
ggccatagtgatgatggggacaaatttgattataatagattttgtcaagaaaagatgagt
tatttctggggcgatttgataaaatttggtatagtgaataaaaacgatctagaaaaatat
gatattagatacatagaatcggaattccttcctgaaacgtatataaaatcgtag

DBGET integrated database retrieval system