KEGG   Naumovozyma dairenensis: NDAI_0J02980Help
Entry
NDAI_0J02980      CDS       T02234                                 

Gene name
NDAI0J02980
Definition
hypothetical protein
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
ndi  Naumovozyma dairenensis
Pathway
Other types of O-glycan biosynthesis
Class
Metabolism; Glycan biosynthesis and metabolism; Other types of O-glycan biosynthesis [PATH:ndi00514]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
10:742714..745005
Genome map
AA seq 763 aa AA seqDB search
MAASKRHSVKSVSPRIDVDDQLFKYTKSNGSKSFEQIAQNWLLKPLPDSQVKYSFWLYAV
TLIACVARFYMIWYPNEVVFDEVHFGKFASYYLERTYFFDVHPPFAKMAIAFIGWLVGYD
GSYKFDDIGDSYETHPAPYIAYRSFNAILGTLTVPILFNTLKELNFKAITCAFGALLVAV
DNAHVTETRLILLDAILLISIASSFYCFVRFYKSQLTSPFSLQWYTWLYATGISLSFVIS
TKYIGVMTYSAIGIGIIANLWQLLDIRAGLSLKLFTRHFSRRLNGLILIPFCIYLFWFWV
HFTVLNKSGPGDVFMSAEFQDTLGDSPLSIGSKQVNFYDIITIKHTDTNAFLHSHLAYYP
LRYEDGRVSSEGQQITGYMHEDINNEWEVLPVKELPSTKGQPVLLNDKIRLRHVSSNTFL
LAHDVASPLYPTNEEITTVSEEDANGPAYKETIFAFQPLKKTDEGYEIRTKNTQFRIFHV
ETAVALWTHNDELLPEWGFEQQEVNGSKDVVNPENHWAIEAITNLDDERKVYTPKVTKSM
SFWSKWFELQNSMFEHNNKLSAEHPFASQPQSWPGGLCGVSFWTSDSQRKQIFFTANIVG
WWIQVISMAVFAGIILADLATRQRGYFALGKITREKLYGPLLFLFLGWACHYFPFFLMHR
QKFLHHYLPAHMIISLFTAGLWEVIFSDCKSLDPSIDEEEAGAKYNECPKIYTPLLAIFF
IVSSVAIVWFFIYFAPLIYGNVSLPPTEVVKRQWFDIKLNFAK
NT seq 2292 nt NT seq  +upstreamnt  +downstreamnt
atggcagcttccaaaaggcacagtgtgaaatcggtgtcaccacgcatcgacgtggacgat
caattattcaaatatacaaaaagtaatggatctaaatctttcgaacaaatagcgcaaaac
tggttattgaaaccattaccagattctcaagttaagtattccttttggttatacgcggtt
acattaattgcatgtgttgcaagattttacatgatttggtacccaaatgaagtcgttttc
gatgaagtccatttcggtaaatttgcatcatattatttagaaagaacctatttctttgat
gttcatcctccttttgccaaaatggccattgcatttatcggttggttagtaggttatgat
ggatcttacaaattcgatgacattggtgatagttatgaaacgcatcctgctccatatatt
gcctaccgttcattcaacgctatattaggtactttaaccgttccaatcttattcaatact
ttgaaagaactgaatttcaaagctataacttgtgcattcggtgccttgttagttgctgtc
gacaatgcccatgtcacagaaacaagattgatcctattagacgcaatccttttaatttct
attgcaagttcattctattgttttgttcgcttttacaagagccaattaacttctccattc
tctttacaatggtacacttggttatatgccacagggatctcattatctttcgtcatttct
actaaatatattggtgtcatgacttattctgcgattggtattggcattatcgccaattta
tggcaacttttggatattagagcaggtttaagtttgaagttatttacaagacattttagt
agaagattaaatggactaattctcattcctttttgtatttatctattctggttctgggtt
cattttacagttctaaataaatccggtccaggtgatgtcttcatgtctgcagaattccaa
gatactttaggtgactctccattgagtattggttccaaacaagtcaatttttacgatatt
attacaatcaaacatactgacacaaacgctttcttacattctcacttggcttattaccca
ttacgttatgaagatggtcgtgtttcttcagaaggtcaacaaatcactggttacatgcat
gaggatatcaataacgaatgggaagttttaccagttaaggaattaccttctacaaaaggt
caaccagtcttactgaatgataaaattaggttaagacatgtcagttcaaataccttctta
ttagcgcatgacgttgcatctccactttatccaacaaatgaagaaatcacaactgtctct
gaagaagatgcaaacggaccagcatataaggaaaccatttttgccttccaaccattgaag
aaaactgatgaaggttatgaaattagaacgaagaacacacaattccgtatcttccatgtt
gaaacagctgtggccttatggactcacaatgacgaactattaccagaatgggggttcgaa
cagcaagaagtgaacggtagtaaagatgtagttaaccctgaaaatcattgggctatagaa
gctatcactaatcttgatgatgaaagaaaagtttacactccgaaagtaaccaagagtatg
tcattttggtcaaaatggttcgaattacaaaactcgatgttcgaacataataacaaactt
tccgcagaacatccatttgcttctcaaccacaaagttggccaggtgggctatgcggagtt
tcattttggacttcagattctcaaagaaaacaaattttctttactgccaatatcgttggt
tggtggatacaagttatctctatggctgtttttgctggtattattttagctgatttagca
accagacaacgtggttattttgcccttggtaaaatcactagagagaaattatatggtcca
ttattattcttattcctcggatgggcatgtcattatttccctttcttcttaatgcatcgt
caaaagtttttgcaccattatctaccggctcatatgatcatatctctatttacagctggg
ttatgggaagttatcttcagtgattgtaaatctctagatccatctatcgatgaagaagaa
gcaggtgccaaatataatgaatgtccaaagatctatacgccattattagccattttcttc
atagtttcatcagttgccattgtttggttcttcatctatttcgctccattaatttatggt
aatgtttccctaccaccaactgaggtagtaaagagacaatggttcgatatcaaactaaac
tttgccaaatag

DBGET integrated database retrieval system