KEGG   Naumovozyma dairenensis: NDAI_0K02120Help
Entry
NDAI_0K02120      CDS       T02234                                 

Gene name
NDAI0K02120
Definition
hypothetical protein
Orthology
K04709  
Acyl-CoA-dependent ceramide synthase [EC:2.3.1.24]
Organism
ndi  Naumovozyma dairenensis
Pathway
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    NDAI_0K02120 (NDAI0K02120)
Enzymes [BR:ndi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.24  sphingosine N-acyltransferase
     NDAI_0K02120 (NDAI0K02120)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:complement(478926..480206)
Genome map
AA seq 426 aa AA seqDB search
MSGSPAPFPRPPLKPMTSTGSKLSVRMGTTRARRTSSVGRIDLGDTVSGLGTMFETKESR
TASKKRMLQLTEASKNDKDLIKKFWLSFREMNYRHTWIAPLIILIIVYSAYFTSGNRTQT
NPLHKFVAISYRVGDTEEYAKGINDLAFVFYYMIFFTFLREFLLDIVLRPIPELLNAQTE
HKKKRILEQMFYIVYYGFSAPFGLYIMYHSDLWFFKTAPMYETYPDLTNPKLFKIFYLGQ
AAFWAQQACVLVLQLEKPRKDHTEMIFHHIVTLLLVWASYVFHFTKMGLAVYITMDFSDF
FLSLSKIFNYLDSPFTPPVFFIFVVCWIYLRHVVNIRILWSVLTEFKTVGDYVLDFATQQ
YKCWISLPIVFVLIAALQLVNLYWLFLIFRILYRMVWKGIVEDTRSDSESDSEEPTTPSA
DEKKGL
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgtcaggatctcctgcacctttccctcgtcctccactcaaaccaatgacctcgacagga
agtaagctctctgttagaatgggaaccaccagagcaagacgtacatcttccgttggaaga
atcgatcttggtgatactgtttctggtcttggtacgatgttcgagacaaaagaatctaga
acagcttccaagaagagaatgttacaattgactgaagcttcaaagaatgataaggatcta
attaagaaattttggttatcattcagggaaatgaactatcgtcatacttggatcgctccg
ttgatcatcttaatcatcgtttatagtgcatacttcacttcaggtaacagaactcaaaca
aatccactgcataaatttgtagccatatcttatagagttggcgacacagaagaatacgct
aagggcattaacgatctagcgtttgtcttctactatatgatcttcttcactttcttaaga
gaattcctcttagatatagtgcttagaccaatccctgaattattgaacgctcaaacagaa
cataagaagaaaagaatccttgaacaaatgttctacatcgtttattatggattctcagct
ccattcggcctctatatcatgtatcattcagacctatggtttttcaaaacagctcccatg
tacgaaacgtatccagatttaactaatccgaaattattcaagatcttttacctaggtcaa
gctgcattttgggctcaacaagcatgtgtcctcgtgcttcaattggaaaaaccaagaaaa
gatcacacagaaatgatcttccatcatatcgtaacattactattagtttgggcctcatac
gttttccatttcaccaaaatggggctagctgtttacatcactatggatttctctgatttt
ttcttatcactttcaaagatatttaattatttggattccccatttacaccaccggtattc
ttcatattcgtagtttgttggatttatctacgtcatgtcgtcaatattagaatcctttgg
tctgtgttaactgaatttaagactgtcggtgattatgtgttggatttcgctactcagcaa
tataaatgttggatctctttaccaatcgttttcgttttgattgcagccttacaattggtt
aatttgtactggctattcttaatctttaggattttatatagaatggtgtggaagggtata
gtagaggatacaagaagtgattctgaatcagattctgaagaaccaacgactccaagcgct
gatgaaaagaaaggactctga

DBGET integrated database retrieval system