KEGG   Naumovozyma dairenensis: NDAI_0K02870Help
Entry
NDAI_0K02870      CDS       T02234                                 

Gene name
NDAI0K02870
Definition
hypothetical protein
Orthology
K04718  
sphingosine kinase [EC:2.7.1.91]
Organism
ndi  Naumovozyma dairenensis
Pathway
Sphingolipid metabolism
Metabolic pathways
Module
Sphingosine degradation
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ndi00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
11:complement(648772..650760)
Genome map
AA seq 662 aa AA seqDB search
MLESASEREEAHQGLLSLNLRPTSRALLTSDGILLKSQNNSCYPISHATAMASEQQYNGT
DPDQTILESKLDPNNILSRANDTMDNPDSNHSTSVLSLLSCISCIDSPTDSHGSLLPINT
TIPYARILNAKYIGPSEAKTNNNDTYRLGYQGQSSLSSSSLSPDPKQQQKTTTKDVQPDN
PFSNEETLSVSSVILKSQNSSMQFLTDNQYMIELSFVIPIEENLIPKKINLIIDYLPSFP
SSNDLVQEIMNRSYKNVSQQRSILIIINPHGGKGKASKLFNKWSKPILSTSNCKFEIINT
TYSSHATDIAKSLDISKYDIIACASGDGIPYEVINGLYQRPDRVDAFNKLTITQIPCGSG
NAMSISCHWTDNTSHATLCLLKSIEKRIDLMCCSQPSYANQSPRLSFLSQTFGVIAESDI
NTEFIRWMGPVRFELGVAYNVIQGKRYPCDIFVKYATKSKDELKSHYIKHKLKNNCENEE
LHFDRNNKSQASLRSLDKQVASSSSSPFNDTEHIVTEQDFIVKYPLDKGVPDDWEKLNPQ
ITDNLNIFYTGKMPYISADTKFFPAALPNDGTFDLIITDISTPLTKITPILLSLDKGAHV
LHPEVIHSKIIAYKMIPKIKDSVISVDGERFPVEPIQVEIMPNLCKTLLRNGSYVDSKFD
LM
NT seq 1989 nt NT seq  +upstreamnt  +downstreamnt
atgctggaatctgcttcagaaagagaagaggctcaccaaggtttactctcattaaactta
agaccaacatcaagagccctgttgacctctgatggtatcctattgaaatcacaaaataat
tcatgttatccgatatcccatgctaccgcaatggcttccgagcaacaatataatggtact
gatccagatcaaaccatattggaaagtaaattggatcctaataacatattgagtcgtgca
aatgatactatggataacccagactcaaaccatagtacgtcagtgctctctttattgagt
tgtatatcatgtatagactctccaacggattcacatggatctcttttacctataaatacc
acaataccatatgcaagaatattaaatgcaaaatatataggtccctcagaggctaaaaca
aataataacgatacttatagattaggttatcaaggtcaatcatcactgtcatcatcatca
ttatctccagatcccaaacaacaacagaaaacaaccacgaaagatgtacaacccgataat
cccttttcaaacgaagaaacattatctgtatcatccgtcatattaaaatctcaaaattca
tccatgcaattcttaactgataaccaatatatgattgaattatcattcgttatacccata
gaggaaaatttaatcccaaaaaagattaaccttataatagattatcttccaagtttcccc
tcatccaatgatttggttcaagaaattatgaatagaagttacaaaaatgtgtctcaacaa
aggtctattttaataataattaacccacacggtggtaaagggaaagcctcgaaacttttc
aataaatggtccaaaccaatcctctccacatcaaattgtaaattcgaaatcataaataca
acatattcatctcatgcaactgatattgcaaaatcattagacatctctaaatatgatata
atagcttgtgcatcaggtgatgggatcccctacgaagtaattaatggcctttatcaacgt
cctgatagagttgatgcatttaacaaattaaccattacacaaatcccatgtggatcagga
aatgcaatgagtatttcatgtcattggactgataacacttcacatgcaacattatgtctc
ttaaaatcaattgaaaaaagaatagatttaatgtgttgttctcaaccgtcttatgcaaac
caatctccacgtttatctttcctctctcaaacgtttggtgtcatcgcggaatctgatatc
aatacagaatttattagatggatgggacccgtaaggtttgaactaggtgtggcatataac
gtcatacaggggaaaagatacccctgtgatattttcgttaaatacgctacaaaatctaaa
gatgaattgaaatctcattatataaaacataaattgaaaaataattgtgaaaatgaagaa
ttgcattttgatcgtaataacaaatcacaagcgtcattacggtcacttgataaacaagtc
gcttcttcatcatcatcaccatttaatgacactgaacatattgtcactgaacaagatttc
atagtaaaatatccattagataagggcgtccctgatgattgggaaaaattaaatccacaa
attactgacaatttaaatattttctatacggggaaaatgccatacatatcagcagataca
aaattcttccccgccgcgttacctaacgatggaacttttgatttaattattactgacatt
tccactccgctaacaaaaattactcctattttattatcattggataaaggtgctcatgtg
ttacatcctgaagttattcattcaaagattatcgcatataaaatgatcccaaagataaaa
gatagtgtaatctcagtggatggtgagaggttccccgtggaaccaatccaagtggaaatt
atgcccaatttatgtaaaactcttttgagaaatggatcttatgtggattccaaattcgat
ctcatgtag

DBGET integrated database retrieval system