KEGG   Nonlabens dokdonensis: DDD_0258Help
Entry
DDD_0258          CDS       T02441                                 

Definition
magnesium-chelatase subunit chlI (EC:6.6.1.1)
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
ndo  Nonlabens dokdonensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ndo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    DDD_0258
Enzymes [BR:ndo01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     DDD_0258
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(298597..300060)
Genome map
AA seq 487 aa AA seqDB search
MEYNKIQTLGDLKKAGWKSKSIKEELRDNLIHNIKNDVDSFTGIHGYENTVIPELERAIL
SRHNINLLGLRGQAKTRLARLMTGLLDEYIPYVTDSEIHDDPLAPISRSAIELIKEHGDK
TPISWLHRDDRFYEKLATPDVTVADLIGDIDPIKAANLKLSYADDRVIHYGMIPRANRCI
FVINELPDLQARIQVALFNILQEGDIQIRGFKLRLSLDMQFIFTANPEDYTNRGSIVTPL
KDRIGSQILTHYPENIAIAKTITQQEAKNDSRTAEAVYVPELAKDVLEQISFCARDSEYV
DEKSGVSARMSITAFENLLSTAERRSLMNGDEKTSIRFSDFTGIIPAITGKVELVYEGEQ
EGAAFVANELIGEATKTLFPQYFPEIKKLVKGDEETPYDKLIEWFFNNEGLELLDELNDN
DYQVLIDQIEPLEDLVQKYQPETTKEDRNFMKEFILWSLVEFDKLSKKRFTEGYQFNDLY
SDFIKGI
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggaatacaataaaatacaaacgctaggtgaccttaaaaaagctggctggaaatcaaaa
tcaataaaggaagaattaagagataatttaattcacaatataaaaaatgatgtcgattca
ttcactgggattcatggttatgaaaatacggtaattccagagctggagcgtgccatatta
tcgcgacataatattaatttgttaggattgcgaggtcaagcaaaaacacgtcttgcaaga
ttgatgacaggcttgctggatgagtatattccttatgtgactgatagtgaaattcacgat
gatccactagcgcctatatctaggagcgctatagaattgatcaaagaacacggtgataaa
acacctatttcatggttacatcgagatgatcgtttttatgaaaaactggcaacgccagat
gttactgtagccgatttaataggagatatagatcctataaaagcagctaatttaaaactt
agttatgctgacgatcgcgtgatccattatggaatgataccgcgcgctaaccgctgtatt
tttgtaatcaatgaattaccagatttacaggctcgtattcaggtggctttgtttaatatt
ttacaagaaggtgatattcaaatacgtggttttaaactgcgcttatcgctagatatgcag
tttatttttactgcaaatcctgaagattatacaaaccgtggtagcatcgtgacgccgttg
aaggacagaataggatcacaaattttaactcattatcctgagaatatcgctattgcgaaa
acaattactcaacaagaagccaaaaacgattccagaactgcagaagcggtttatgtgcct
gagcttgcaaaagatgttctagagcaaatcagtttttgtgcgagagacagtgagtatgtg
gacgaaaaaagtggtgtaagtgcgcgtatgagtattaccgcttttgaaaatttattgagt
actgcagagcgacgttcattgatgaatggcgatgagaaaacaagtattagattttctgac
tttacaggaattattccagcaattacaggtaaagtagagttggtttatgaaggcgaacaa
gaaggagcagcatttgtagcaaatgaattgataggtgaggcgactaaaactttatttcca
caatatttcccagagattaaaaaactggtaaaaggtgatgaggaaactccttatgacaaa
ctcatagaatggtttttcaataatgaaggtctagaattattggacgaattgaatgacaat
gattatcaagtgctgattgatcaaattgaaccattagaagaccttgtgcaaaaataccag
ccagagacaactaaggaagatcgtaattttatgaaagaatttattctttggtctcttgtt
gaatttgataaactgagtaaaaaacgctttactgaaggttaccagttcaatgatttatac
agcgactttattaaaggtatttaa

DBGET integrated database retrieval system