KEGG   Nonlabens dokdonensis: DDD_0592Help
Entry
DDD_0592          CDS       T02441                                 

Gene name
asnB
Definition
asparagine synthetase B, glutamine-hydrolyzing (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ndo  Nonlabens dokdonensis
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ndo00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    DDD_0592 (asnB)
Enzymes [BR:ndo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     DDD_0592 (asnB)
Peptidases [BR:ndo01002]
 Cysteine Peptidases
  Family C44
   DDD_0592 (asnB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
647821..649482
Genome map
AA seq 553 aa AA seqDB search
MCGIVGVFQLKKESSEQREAVLELSKKIRHRGPDWSGIYCGDNAILAHERLTIVDPQSGG
QPLYSPDGNIVLAVNGEIYNHQEIRSRYPEYDFKTKSDCEVILALYQDKGVNFMDELTGM
YGFALYDSVKDVFLCARDHQGIIPLYYGTDDMGQFYVASELKALEGTCNEISPFPPGNYY
YSEGGDFTKWYDREWKDYKTVKDNSSSVADLKKAMEDSVHRHLMSDVPYGVLLSGGLDSS
IVSAVAKKYASRRVESGDHADAWWPQLHSFAIGLEGSPDLEAAQKVADHIGTVHHSVHFT
IQEGLDAIKDVVYFLETYDVTTIRASTPMYLLARVIKSMGIKMVLSGEGSDEIFGGYLYF
HKAPNAEEFHKETVRKLDTLHLYDNLRANKSLAAWGIEGRVPFLDKEFIDVAMNLNPKDK
MCGNGKMEKHILREAFEDYLPKSVAWRQKEQFSDGVGYSWIDTLKEVVENVVTDEMMEAA
PFKFKINPPQNKEEYYYRSIFSEHFPSDAAAKCVPSLKSVACSTPVALEWDAAFKNMNDP
SGRAVSGVHDEGY
NT seq 1662 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggtatcgtaggagtttttcaactcaaaaaagaaagtagtgaacaaagagaagct
gttctagaattatcaaaaaaaattaggcatcgtggtccagactggtctggtatttattgt
ggcgataatgccattctagctcatgaaaggttaacaattgtagatccacaatctggtggg
caacctttatacagtccagatggaaatattgtacttgcagtaaacggagaaatttacaac
catcaagaaatacgtagtaggtatccagaatacgattttaaaacgaagtcagactgtgaa
gtgatacttgctttataccaagataaaggcgtaaactttatggatgagcttactggaatg
tacggttttgcattatatgatagtgtcaaggatgttttcctttgcgctcgagaccatcaa
ggaattatacctttatactatggcacagatgatatgggacagttttatgtagctagtgag
ctcaaggcacttgaaggaacttgtaacgaaataagtccattcccgccaggaaactattac
tacagtgaaggtggagattttactaaatggtatgatagagaatggaaagattataaaaca
gtaaaagacaattctagctctgttgcagaccttaaaaaagcaatggaagattctgttcac
agacatttgatgagcgatgtaccgtatggtgtattactttctggtgggctagacagttcg
atagtaagtgctgtggcaaaaaaatatgcttcaagaagagtagaatctggtgatcatgca
gatgcatggtggccgcagttgcactcatttgccataggactagaaggtagtcccgatcta
gaagctgctcaaaaagtagcagatcatataggaacagttcaccatagtgtacactttact
atccaagaaggactcgatgccattaaagatgtagtgtattttctagaaacttatgatgta
actaccatcagagcctctacacctatgtatttacttgctagagttatcaaatctatggga
attaaaatggttctttctggagaaggaagcgatgagattttcggaggttatttatacttt
cacaaagctcctaatgcagaagagtttcacaaagaaacagtgcgcaaattagacacattg
catttatatgacaacttaagagcaaacaaatcgcttgctgcgtggggaattgaaggtcgt
gtgccgtttttagataaagaatttattgacgttgccatgaatttaaatcctaaagataaa
atgtgcggcaatggaaaaatggagaaacacatcttgcgagaggcctttgaagattactta
cctaagagtgttgcctggaggcaaaaggaacagtttagcgatggtgtaggctacagctgg
attgataccttaaaagaagtagtagaaaatgtagtgactgatgaaatgatggaagcggct
ccttttaaatttaaaatcaatccgccgcaaaataaagaggagtattattaccgtagtatt
ttctcagaacattttccaagtgatgccgctgcaaaatgtgtaccttctttaaagtcagta
gcttgttctactccagtagcattagaatgggacgctgcttttaaaaatatgaatgatcct
tctggtcgtgcagtaagcggagtgcatgatgaaggttattaa

DBGET integrated database retrieval system