KEGG   Nonlabens dokdonensis: DDD_0597Help
Entry
DDD_0597          CDS       T02441                                 

Gene name
trpC
Definition
indole-3-glycerol phosphate synthase, IGPS (EC:4.1.1.48)
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ndo  Nonlabens dokdonensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ndo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DDD_0597 (trpC)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    DDD_0597 (trpC)
Enzymes [BR:ndo01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     DDD_0597 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
653196..653999
Genome map
AA seq 267 aa AA seqDB search
MEDILKKITNQTAEDLKVRKDKTSLSQLREMHFYSRKTLSLYKGLKNGSGIIAEHKRQSP
SKGSFNCPASLQDVVKGYEAAGASAISCLTDEPFFGGTLQDLLEARKSVNIPILRKDFII
DLYQIHEAKAYGADAILLIAACLNNEELIAMSVEAMNLGLEILFEVHDLEELNRIKEVTS
SMNTSKFVIGVNNRDLKKFKTDIQNSKDLLPHFPENVLAISESGISDPQIVKELKNIGFE
GFLIGENFMKTDQPGTSCKQFIKAIQS
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggaagacatcctaaaaaaaataacaaatcaaactgctgaagacttaaaggttagaaaa
gataaaacttctctttctcaattaagagaaatgcacttctactcaagaaaaaccttgtca
ttatataagggtttaaaaaacggtagcggcatcatagcggaacataaaagacaaagtccg
agcaaaggatcgttcaattgcccggctagtttacaagatgtggtcaaaggttatgaagca
gctggtgctagtgcgataagctgtttaacggacgagccattttttggtgggacattacaa
gatttactggaagcaagaaaatcggttaacattcctatcctgcgcaaggacttcattatt
gatttatatcaaattcatgaagccaaagcctacggagcagacgccattctactcatagca
gcttgcttgaataatgaagaattaatagccatgtcggtcgaagctatgaatctaggattg
gaaattctatttgaagtacacgatctagaagagctcaatcgtataaaagaagtgacctct
tcaatgaacacttcaaaatttgtgataggtgtcaacaaccgagacttaaagaaatttaaa
actgatattcaaaacagtaaagatttattacctcattttcctgaaaatgttttggccatt
tcagaaagtggaatttctgatccacaaatagtaaaagagcttaaaaatataggatttgaa
ggttttttaataggagaaaactttatgaaaacagatcaaccaggaactagctgtaaacaa
tttataaaagcgattcaatcatga

DBGET integrated database retrieval system