KEGG   Nonlabens dokdonensis: DDD_1441Help
Entry
DDD_1441          CDS       T02441                                 

Gene name
rmlC
Definition
DTDP-4-dehydrorhamnose 3,5-epimerase (EC:5.1.3.13)
Orthology
K01790  
dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
ndo  Nonlabens dokdonensis
Pathway
Streptomycin biosynthesis
Polyketide sugar unit biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ndo00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    DDD_1441 (rmlC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    DDD_1441 (rmlC)
Enzymes [BR:ndo01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     DDD_1441 (rmlC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1543045..1543569
Genome map
AA seq 174 aa AA seqDB search
MSPTPLFDCIIIEPAVFPDARGKFVVAFDSIAFAKAVPKQKPFITTNESTSTYGVLRGLH
AQKGEAAQAKLVRCISGRILDVVVDYRPESPTYLKHFTTELSGENNKQLLVPRGFLHGFS
VLSETAIVNYQIDNTYQPDMEIGIRYDDPKLNIDWQLPKEDIILSEKDEKLGYL
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcctactcctctgtttgattgtattatcatagagcctgcggtttttccagatgct
cgaggcaaatttgtagtagcctttgatagtatcgctttcgcgaaagcggttccaaaacaa
aaaccatttattacgacaaatgaaagtacctctacctacggtgttttgagaggattgcat
gcacaaaaaggcgaagctgctcaagcaaaattagtacgctgtattagtggtcgtattctc
gatgttgtagtagattataggccagaatcacctacttatttaaaacatttcactaccgaa
ttatctggtgagaataacaaacaacttttagttcctaggggttttttacacggcttttct
gtactttctgaaacggcaatcgtgaattatcaaatagataatacttatcaaccagatatg
gaaataggcatcagatatgatgatcctaagttaaacatagactggcaattgcctaaagaa
gatattattctatctgagaaggatgagaaattaggctatttgtaa

DBGET integrated database retrieval system