KEGG   Nonlabens dokdonensis: DDD_1723Help
Entry
DDD_1723          CDS       T02441                                 

Gene name
dfrA
Definition
(GenBank) dihydrofolate reductase
  KO
K00287  dihydrofolate reductase [EC:1.5.1.3]
Organism
ndo  Nonlabens dokdonensis
Pathway
ndo00670  One carbon pool by folate
ndo00790  Folate biosynthesis
ndo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DDD_1723 (dfrA)
   00670 One carbon pool by folate
    DDD_1723 (dfrA)
Enzymes [BR:ndo01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     DDD_1723 (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHFR_1 2TM DUF1154
Motif
Other DBs
NCBI-ProteinID: AGC76850
UniProt: L7W5D6
Position
complement(1841602..1842504)
Genome map
AA seq 300 aa AA seqDB search
MFGKKNKEHTGIDLEQKELIENAQRRIKQKRGLFTHFVVFLVGAVGLIIISQVLMQVEPV
KVLGIEWWIWIVFAWFLLLCYHAFKVFITNRLLGPEWEKKQYDRLVTKQQKRIQELEKKV
EKEYIAPKTKLVLDNDDTKRKITMIAAAGQNNELGKDGDLVWHLPDDFKRFKALTTGHHI
IMGRKTFESFPKPLPNRTHIILTRDKNYKTEGGIVVHDLETALATTSGDENPFIIGGGEI
YKLGMKVADEIELTRVHGTFDVDTYFPEIDESKWKIKTSLHHPADDKHKYSFDYETWVRK
NT seq 903 nt NT seq  +upstreamnt  +downstreamnt
atgtttggcaagaagaacaaagaacacaccggaatagatttagagcaaaaagaactcata
gaaaatgcgcaacgacgtatcaaacagaaacgcggtttatttacgcacttcgtagttttc
ttagtaggtgcggtaggtcttatcattataagtcaagtacttatgcaagttgaaccagta
aaggttctaggcatagaatggtggatttggattgtttttgcatggtttttactgttatgc
tatcatgcttttaaagtatttattactaatcgattgttaggtccagaatgggagaaaaag
caatacgatcgtctcgtaactaagcaacaaaaacgtattcaagaacttgaaaaaaaagtt
gaaaaggaatacatcgctcctaaaacaaagcttgttctagataatgatgacaccaaaaga
aaaataaccatgatcgcagcagctggtcaaaacaatgaattaggtaaagatggagacctg
gtatggcatttaccagatgattttaaaagatttaaagctttaactacaggtcaccacatc
atcatgggccgcaaaacttttgaaagttttcctaagccattacctaatcgtacacatatc
atacttactagagataaaaattacaaaactgaaggcggcattgtcgttcatgatctagaa
acagcacttgccaccacttctggcgatgagaatccgtttattataggtggcggcgagatt
tataaactaggaatgaaagtagctgatgaaattgagctgacaagagttcatggaacattt
gatgtagatacttatttcccagaaatagacgagagcaaatggaagatcaaaacatcactt
catcatccagccgatgataagcataagtatagttttgattatgaaacctgggtgagaaag
tag

DBGET integrated database retrieval system