KEGG   Nonlabens dokdonensis: DDD_2103Help
Entry
DDD_2103          CDS       T02441                                 

Definition
GTP cyclohydrolase I (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ndo  Nonlabens dokdonensis
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndo00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    DDD_2103
Enzymes [BR:ndo01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.16  GTP cyclohydrolase I
     DDD_2103
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2308556..2309227)
Genome map
AA seq 223 aa AA seqDB search
MKIEDLLENIEDNDHLSSNEQTPLRPDAFDMSDADKIASIKKDVHNILETLGMDMTDDSL
KGTPNRVAKMFVNEIFGGLRPDRKPSASTFENKYKYNEMLVEKDIVVYSTCEHHLLPIVG
RAHVAYISNGSVVGLSKMNRIVDYYAKRPQVQERLNIQIVRELQQVMNTEDVACIIDAKH
LCVNSRGIRDIESSTVTGEFGGKFKDPAVKREFLDYIKMDTKF
NT seq 672 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattgaagatctactagaaaatatagaagataatgatcatttgtcttctaacgag
caaaccccattacgtcctgacgcctttgatatgagcgatgcagataaaattgcatccatt
aaaaaagatgtacataacattctagagactctaggtatggacatgacagatgacagtcta
aaaggaacacctaatcgcgttgcaaaaatgtttgtcaacgagatttttggaggcttacgc
ccggatagaaaacctagcgccagtacttttgaaaataaatacaagtacaatgaaatgctc
gtagaaaaagacatcgttgtttactcaacttgcgagcatcacttgcttcctattgtaggt
cgtgcacacgttgcttatatctcaaatggtagcgtggtaggactttctaaaatgaatcgc
atcgtagattattatgcaaaacgaccacaagttcaagagcgacttaacattcagattgta
agagagttacaacaagtcatgaatacagaagatgtggcctgtatcatagatgcaaaacac
ctttgtgtaaacagtcgtggtataagagatatcgagagcagcactgtgacaggggaattt
ggcggtaaatttaaagacccagctgttaagagagagtttctcgattatattaaaatggac
actaagttttaa

DBGET integrated database retrieval system