KEGG   Nonlabens dokdonensis: DDD_2363Help
Entry
DDD_2363          CDS       T02441                                 

Definition
glycosyl hydrolase, family 30 (EC:3.2.1.45)
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ndo  Nonlabens dokdonensis
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ndo00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    DDD_2363
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    DDD_2363
Enzymes [BR:ndo01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     DDD_2363
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2582409..2583929
Genome map
AA seq 506 aa AA seqDB search
MKLKSYGTICMLILLMTSCKNLNESQSMVDDNKLDVKVYETSAAGNNLTEVTPFTVADSA
AIITINEDKKFQTITGFGGAFTESSAYLLNRLSKKNRDTIINAYFSRAGANYSLTRTHMN
SCDFSLSQYSFSPVENDMNLEHFTIEEDRDDLIPMIKDAMAASEDGFDIFASPWTAAPWM
KDNNKWVGGKLLPKYYDTWALFFSKYIDAYEAEGIPIWGFTVENEPHGNGNNWESMHYTP
KEMTDFVEFHLGPKLEADGHGDKIILGYDQNRAGLREWVDEMYRDEASSKYFDGTAIHWY
ESTYDYFPEELQYAHNKAPDKYLIETEGCVDSEVPAWKDDNWYWSKEATDWGWDWASEED
KHLHPKYAPVNRYARDIIGCMNNWVDGWVDWNMVLDKQGGPNWFENWCAAPVIVDPENDE
VYFTPLYYTMAHFSKFIRPGAEVIEANNTDKNLMVTAAKNPDGTIAVVVFNEGMEDKSYS
LRFRESEINIKLGPQSLQTVLIPNQN
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgaaactaaaatcttatggaacaatttgcatgctaattcttcttatgacaagctgtaaa
aatctcaatgaatctcagtcaatggttgacgataataaacttgatgtaaaggtgtatgaa
acatctgcagcaggtaataacctaactgaggtaacaccttttaccgttgctgacagtgca
gccatcattacaataaatgaagataaaaagtttcaaactattacgggctttggcggcgca
ttcacagaatcttctgcctatttgctcaatcgattgagcaaaaaaaacagagatacgatt
ataaatgcatatttctctagagcaggagctaactactctctaacgcgcacgcacatgaac
agttgtgatttctcattatcacagtattctttttctcccgtagaaaatgatatgaatcta
gagcacttcaccattgaggaagatcgtgatgatttgatccctatgattaaagatgctatg
gcggcttcagaagatggctttgatatttttgcttcaccatggacagcagctccttggatg
aaggacaacaacaaatgggtaggaggcaagctgcttcctaaatattatgacacctgggca
cttttcttttctaaatatatagatgcttacgaggcagaaggtattcctatatggggtttt
acggtagaaaatgaacctcacggaaatgggaataactgggaaagtatgcattatacacct
aaagaaatgacagattttgtcgagtttcacttaggtcctaaactggaagcagatggtcat
ggagataaaattatattaggatacgatcaaaatagagcaggacttagagaatgggtagat
gagatgtacagagatgaagcttcctcaaaatattttgacggtacagcaattcactggtat
gaaagtacctatgattactttccagaagaattgcaatatgctcataacaaagcaccagat
aaatatttaatagagacagaaggatgcgtagattctgaagtgccagcttggaaagatgat
aactggtactggtctaaagaagcaaccgattggggttgggactgggcaagtgaagaagat
aaacatttgcaccctaagtatgccccagtaaatcgttatgcacgtgatattataggctgt
atgaataactgggtagacggttgggtagactggaatatggtactggacaaacaaggtggt
cctaactggtttgaaaactggtgtgcggctcctgtgattgtagatccagaaaatgatgag
gtttatttcacgccattgtattataccatggcacatttcagcaagtttatacgacctggt
gctgaggtgatcgaagcaaataatacagataaaaacttgatggttaccgccgcaaaaaat
cctgatggaactattgctgtggtagtttttaatgaaggcatggaggataaaagttattcg
ttacgctttcgcgaaagcgagatcaacatcaaactaggtcctcaaagtctacagaccgtt
ttaataccaaaccaaaactaa

DBGET integrated database retrieval system