KEGG   Nonlabens dokdonensis: DDD_2904Help
Entry
DDD_2904          CDS       T02441                                 

Gene name
murA
Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase (EC:2.5.1.7)
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ndo  Nonlabens dokdonensis
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ndo00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ndo00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3138727..3140037
Genome map
AA seq 436 aa AA seqDB search
MGTFIIEGGHQLKGEIQPQGAKNEALQILCAVLLTDQPVEINNVPDIIDVNKLIALLNNL
GVKVTKNGKESYTFQADNINLDWLQSEEYKIQGRGLRGSIMLVGPLLARFGKGYIPRPGG
DKIGRRRLDTHFEGFIKLGAKFRYNKEEYFYGVEADELHGAYMLLDEASVTGTANIVMAA
VLAKGKTTIYNAACEPYLQQLCNMLVRMGANISGIGSNMLIIEGVEKLGGTTHRILPDMI
EIGSWIGLAAMTKSEVTIKNVSYDELGIIPATFRKLGITIERQGDDIHIPAHTDGYEIQN
YIDGSILTISDAPWPGFTPDLLSIVLVVATQARGSVLIHQKMFESRLFFVDKLIDMGAKI
ILCDPHRASVIGYDFQSQLKATTMTSPDIRAGISLLIAALSAKGTSTIHNIEQIDRGYQN
IDTRLRAIGAKITRLE
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgggaacatttattatcgaaggtggacatcaattaaaaggagaaattcaacctcaaggt
gctaaaaatgaagcgcttcaaatactttgtgcggtcttattaaccgaccagccagtagaa
atcaataacgttcctgacattatagatgtcaataaattgatcgctttactcaacaatcta
ggcgttaaagtgactaaaaacggtaaagaatcctacacttttcaagccgataatatcaac
ctggactggttacagtctgaagaatataaaatccaaggtcgtggcttgcgtggttccatc
atgttagtaggtccattactggctcgttttggtaaaggatacattccgcgtcctggtgga
gataaaatcggtcgtcgtcgtctggacacgcactttgaaggttttatcaaactaggcgca
aaattcaggtacaataaagaagaatatttctacggtgtagaagcagacgagcttcacggt
gcttacatgttgctcgatgaggcatcggtaacaggtaccgcaaacatcgtgatggcagcc
gttcttgccaaaggtaaaactaccatctacaacgctgcttgtgagccatatttacagcaa
ttgtgcaacatgctcgtgcgcatgggtgctaacatttctggaataggttctaatatgttg
atcatagaaggagtggaaaaattaggtggtacgacgcaccgcattctgccagatatgatt
gagataggtagctggataggtcttgctgcgatgactaagtctgaggtgacgatcaaaaac
gtttcttatgacgagttgggaatcattccagccacatttagaaagctaggaatcactatc
gagcgtcagggcgatgacattcacattcctgcacataccgatggttatgagatccagaat
tatatagatggttcgattctaaccatttctgacgcgccatggccaggtttcacaccagat
ttattgagtattgttctagtggtggcaacgcaggctagaggtagtgtgttgattcaccaa
aagatgtttgaaagccgcttgtttttcgttgataaattgatcgacatgggtgctaaaatc
attctttgtgatccgcatagagcgagtgtgattgggtatgattttcagtcgcagttaaaa
gcaacaaccatgaccagtccagacatccgcgccggaatctctttattgatcgctgctttg
agtgccaaaggtactagcaccattcacaacattgagcaaatagaccgtggttatcaaaac
atcgacacgcgtttgcgtgctataggagcaaagatcactcgtttagaataa

DBGET integrated database retrieval system