KEGG   Nonlabens dokdonensis: DDD_3293Help
Entry
DDD_3293          CDS       T02441                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ndo  Nonlabens dokdonensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ndo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DDD_3293
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DDD_3293
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DDD_3293
Enzymes [BR:ndo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DDD_3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3536205..3537500
Genome map
AA seq 431 aa AA seqDB search
MKYYSLNKKAPKTSFEQAVVKGLAPDKGLYFPEEIQPLDKSFFDNIEQISREEIAFQAIQ
QFVSPEIPKKVLRQIIKETIDFDFPIVSLNNEISTLELFHGPTMAFKDVGARFMARCLGY
FNQNNKEEITVLVATSGDTGGAVAHGFLGVKGIKVVILYPKGKVSNVQEKQLTTLGQNIT
ALEVDGVFDDCQDMVKRAFLDQDLTSKMQLTSANSINVARWLPQMFYFFFTYQQLKSKYK
QLVFSVPSGNFGNICAGMIAKKLGLPIEHFIAANNENNVITKFLKTKEYVPEPTIATLSN
AMDVSNPSNFVRIQEIYDQDFEVLKKDLTSYFYTDKATEKALIEIKEKYNYIADPHGAIG
YLACKDYLKENENVHCVFLETAHPTKFLPTVERVLNETVALPDQIKELMNKKKVAIEISN
YGGLKNFLLSK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattactcattaaataaaaaagctcctaaaactagttttgaacaggccgttgtt
aaaggacttgcgcctgataaaggtctttattttccagaagagattcagccgctggataag
tctttctttgataatatagagcaaataagccgtgaagaaattgcattccaagctattcaa
caatttgtaagtccagaaataccaaaaaaagttctacggcaaattattaaagaaacaatt
gattttgactttcctatcgtgtcattgaataatgagatttctacccttgaattatttcac
ggccctaccatggcatttaaagatgtaggagctcggtttatggcaagatgtttaggctat
ttcaatcaaaataataaagaagagataacagtacttgtagctacatctggtgatacaggt
ggagctgtagctcacggatttttaggtgtaaaaggaattaaagtagtgatcctttaccct
aaaggaaaagtaagcaatgtgcaagaaaaacagttaactaccttaggacagaatatcaca
gcattagaagtagatggtgtttttgatgattgtcaagatatggttaaacgtgctttctta
gatcaagatctgacctcaaaaatgcaattgaccagcgccaattctattaacgtggcacga
tggttacctcaaatgttttacttcttttttacctatcaacagctaaaaagtaaatacaag
caattggtcttttcagtacctagcggaaactttgggaatatttgtgcaggaatgattgca
aaaaaactaggacttcctattgaacattttatagctgctaataatgagaataatgtgatt
actaagtttctcaagacaaaagaatatgttccagagcctactattgcaactttaagcaat
gcgatggatgtttctaatcctagtaattttgtacgtattcaagaaatttacgatcaggat
tttgaagttctaaaaaaagacctcacctcctatttttacaccgacaaggcaaccgagaaa
gcattaatagaaatcaaagagaaatacaattatatcgccgatcctcatggtgctataggt
tatttagcttgtaaagattatttaaaagaaaatgaaaatgttcattgtgtttttctagaa
accgcacatccaacgaaatttttacctaccgtagagcgtgttcttaatgagaccgtcgca
cttccagatcaaataaaagaattaatgaataagaagaaggtagctatagaaatcagcaat
tatggtggtttaaagaactttctactttctaaatag

DBGET integrated database retrieval system