KEGG   Nonlabens dokdonensis: DDD_3293Help
Entry
DDD_3293          CDS       T02441                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ndo  Nonlabens dokdonensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ndo00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    DDD_3293
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    DDD_3293
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    DDD_3293
Enzymes [BR:ndo01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     DDD_3293
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3536205..3537500
Genome map
AA seq 431 aa AA seqDB search
MKYYSLNKKAPKTSFEQAVVKGLAPDKGLYFPEEIQPLDKSFFDNIEQISREEIAFQAIQ
QFVSPEIPKKVLRQIIKETIDFDFPIVSLNNEISTLELFHGPTMAFKDVGARFMARCLGY
FNQNNKEEITVLVATSGDTGGAVAHGFLGVKGIKVVILYPKGKVSNVQEKQLTTLGQNIT
ALEVDGVFDDCQDMVKRAFLDQDLTSKMQLTSANSINVARWLPQMFYFFFTYQQLKSKYK
QLVFSVPSGNFGNICAGMIAKKLGLPIEHFIAANNENNVITKFLKTKEYVPEPTIATLSN
AMDVSNPSNFVRIQEIYDQDFEVLKKDLTSYFYTDKATEKALIEIKEKYNYIADPHGAIG
YLACKDYLKENENVHCVFLETAHPTKFLPTVERVLNETVALPDQIKELMNKKKVAIEISN
YGGLKNFLLSK
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgaaatattactcattaaataaaaaagctcctaaaactagttttgaacaggccgttgtt
aaaggacttgcgcctgataaaggtctttattttccagaagagattcagccgctggataag
tctttctttgataatatagagcaaataagccgtgaagaaattgcattccaagctattcaa
caatttgtaagtccagaaataccaaaaaaagttctacggcaaattattaaagaaacaatt
gattttgactttcctatcgtgtcattgaataatgagatttctacccttgaattatttcac
ggccctaccatggcatttaaagatgtaggagctcggtttatggcaagatgtttaggctat
ttcaatcaaaataataaagaagagataacagtacttgtagctacatctggtgatacaggt
ggagctgtagctcacggatttttaggtgtaaaaggaattaaagtagtgatcctttaccct
aaaggaaaagtaagcaatgtgcaagaaaaacagttaactaccttaggacagaatatcaca
gcattagaagtagatggtgtttttgatgattgtcaagatatggttaaacgtgctttctta
gatcaagatctgacctcaaaaatgcaattgaccagcgccaattctattaacgtggcacga
tggttacctcaaatgttttacttcttttttacctatcaacagctaaaaagtaaatacaag
caattggtcttttcagtacctagcggaaactttgggaatatttgtgcaggaatgattgca
aaaaaactaggacttcctattgaacattttatagctgctaataatgagaataatgtgatt
actaagtttctcaagacaaaagaatatgttccagagcctactattgcaactttaagcaat
gcgatggatgtttctaatcctagtaattttgtacgtattcaagaaatttacgatcaggat
tttgaagttctaaaaaaagacctcacctcctatttttacaccgacaaggcaaccgagaaa
gcattaatagaaatcaaagagaaatacaattatatcgccgatcctcatggtgctataggt
tatttagcttgtaaagattatttaaaagaaaatgaaaatgttcattgtgtttttctagaa
accgcacatccaacgaaatttttacctaccgtagagcgtgttcttaatgagaccgtcgca
cttccagatcaaataaaagaattaatgaataagaagaaggtagctatagaaatcagcaat
tatggtggtttaaagaactttctactttctaaatag

DBGET integrated database retrieval system