KEGG   Nanoarchaeum equitans: NEQ511Help
Entry
NEQ511            CDS       T00152                                 

Definition
succinyl-diaminopimelate desuccinylase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
neq  Nanoarchaeum equitans
Pathway
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:neq01230]
Metabolism; Amino acid metabolism; Lysine biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(455624..456742)
Genome map
AA seq 372 aa AA seqDB search
MIDMDFFLQLLKFKTFNPNKEEKEKAAKFIKNYLENKGFDVEIIYSENDTPNILAKYPGK
GKKVAFVTHFDVVPPGEGWNTDPFDPKVEGNKIIARGAADDKSAIVASIAGIENAKEINV
QPILAIAGGEETQESTQFFEQIDSDIALVIDTGPYVSIGSSGFLGINIYVEGKQVHSAHA
YRGENAIYNAAKVIEFIEHISKAFEKTLLSKYQFIEHYDRVPVRVNPTKIEVKPNVINII
PGEVKIYVNARTVPEYDNDYVFNKVSDLLKEFASKNNIKLRIEKDKLELPPWVSDGEHVD
KFIQLTKDLLGEKKILELGGTDGYHFYKRGIKVIQFGPMREENNIHGPNEFVYIEDVERV
AEVIKRVVENGL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgattgatatggatttctttttgcaattgttgaaattcaaaacatttaatccaaacaaa
gaagaaaaagagaaagctgcgaaatttataaaaaactatttagaaaataaaggatttgat
gttgaaataatttacagcgaaaacgataccccaaatattttagcaaaataccccgggaaa
ggtaagaaagttgcttttgttacacattttgatgttgttccccctggagaaggttggaac
acagatccttttgatccaaaagtagaaggaaacaaaataatcgctagaggtgctgcagat
gacaaatcagcgatagtagcatctattgcaggaatagaaaatgctaaagaaataaatgta
caacccatattagctatagccgggggagaagaaacccaagaatcaacacaatttttcgaa
caaatagatagcgatatagcattagttatcgatacggggccttatgtttctataggtagc
tctggtttcctaggaataaacatatatgtggaaggaaaacaagtgcattcagcccatgcc
tataggggggaaaacgcaatatacaatgccgcaaaggttatagagtttatagaacatatt
tctaaagcttttgagaaaactttattgtctaaataccaatttattgagcattacgataga
gtaccagttagggttaaccctacaaagatagaggttaaaccaaatgttattaacataata
ccgggagaagtaaaaatttatgtaaacgctagaacagtgccagaatacgataatgattat
gtttttaacaaggtaagcgatttgttgaaagaattcgcatccaaaaacaacataaaacta
agaatagagaaagacaaattagaattacccccatgggttagcgatggagaacatgtagac
aaattcatacaactaacaaaagatttgttaggagaaaagaaaatcctagaattaggagga
acagatggataccatttctataaaagaggtataaaagttatacaatttggccccatgagg
gaagaaaataatatacatggaccaaacgagttcgtttatattgaagatgtagagagggtt
gcagaagtaataaagagagttgtagaaaatggcttataa

DBGET integrated database retrieval system