KEGG   Nitrosomonas eutropha: Neut_0133Help
Entry
Neut_0133         CDS       T00393                                 

Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
net  Nitrosomonas eutropha
Pathway
net00400  Phenylalanine, tyrosine and tryptophan biosynthesis
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01130  Biosynthesis of antibiotics
net01230  Biosynthesis of amino acids
Module
net_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Neut_0133
Enzymes [BR:net01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Neut_0133
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C Cellulase
Motif
Other DBs
NCBI-ProteinID: ABI58421
JGI: Neut0133
UniProt: Q0AJQ0
Position
complement(132021..132941)
Genome map
AA seq 306 aa AA seqDB search
MSDILDRILAVKKQEISATQTQKSLDKIHDEARAVPAPRDFLQAIRSRINQNHAAVIAEI
KRASPSKGLLRGQTESQNVSGSGHVGNLSGRNPILEDFIPTDIAASYARNGAACLSVLTD
EQFFMGNADFLRQARAACDLPVLRKDFMLDEYQVYEARAMGADCILLIVAAFFSPIFQHD
SAINQGDSALERMHKLETIAQELGMAVLVEVHNADELDLALQLSTPLIGINNRNLKTFET
TLDTTLQLVKHIPSGRIIVTESGIRTPADVEMMLSHCIHTFLIGETFMRAPDPGVALANL
FTTNLA
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgtcagatattcttgatcgcatcctcgccgtaaaaaagcaggagatttcagctacccaa
acacaaaaatcactggataaaattcatgacgaagcacgggcagtacccgctccacgtgat
tttctccaggccatacgcagccggattaatcaaaaccacgctgctgtcattgcagagatc
aaacgggccagcccaagcaagggcttattgcgcggacaaacagagtcacaaaatgtttct
ggatcaggacatgtgggaaatttatccgggcggaatccgatcctggaagattttatcccg
acagacattgcagccagttacgccagaaacggggcggcctgtctatccgtgctgacggat
gagcagttcttcatgggcaatgctgattttttacggcaggcacgcgctgcttgtgattta
ccggtgctgcgcaaggattttatgttagacgaatatcaggtctacgaagcgcgtgccatg
ggtgccgattgtattctgctgatcgttgcagcctttttttcacccatttttcaacatgat
tccgctatcaatcaaggtgacagtgcactcgaacggatgcacaaactggaaaccattgca
caggaactgggcatggccgtactggtggaagtgcataacgcagatgagcttgatctcgca
ttacaattgtccacaccattgatcggaatcaacaaccgtaatctgaaaacgtttgaaacc
acactggatacgaccttgcagctggtcaaacatatcccgtccggacgaattatcgttacc
gaaagtggcattcgtacaccagctgatgtagaaatgatgctatctcattgcatccacact
tttctgatcggggaaaccttcatgcgcgcaccggaccctggtgttgcgctggcaaacctg
ttcacaacaaatctggcgtaa

DBGET integrated database retrieval system