KEGG   Nitrosomonas eutropha: Neut_0218Help
Entry
Neut_0218         CDS       T00393                                 

Definition
class II aldolase/adducin domain-containing protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
net  Nitrosomonas eutropha
Pathway
Fructose and mannose metabolism
Class
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:net00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
222829..223611
Genome map
AA seq 260 aa AA seqDB search
MSGETFDLDKQQLMQREFDQMENKLPGAIYSLRQKVALTCRILFDNGHDSGLAGQITARG
EVPGTFLTQRLGFGFDEISAGNLLLVDEDLLVLEGEGMPNPANRFHSWVYRARPDVHCIV
HSHALHTAALSMLETPLIISHMDNCVLYGDVAFLPKWPGVPVGNEEGGLIAEALGSKRAL
MLAHHGLLVACSNVEEACLIALAFERAARMQLLASAVGEIQPIDPTLGREAHDWILHAQR
SASAFAYYARRSLKHCSDCL
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgagtggtgaaacgtttgatcttgacaagcagcagttgatgcaacgtgaattcgatcag
atggagaataagctgccgggggcaatttattctctgcgccagaaggtagctttgacttgt
cgtattttatttgataatggccatgattccgggctggccggacaaattaccgcgcgcggg
gaggtgccgggcacgtttttgacgcagcggctgggattcggttttgacgagatcagtgcc
gggaatttgttgctggttgatgaggatttgctggtgctggaaggggagggtatgcctaat
cccgcgaatcgttttcattcctgggtatatcgtgcacgccccgatgtacattgcattgtc
cactcccatgcattgcatacagcggcactgagtatgctggaaacaccactcatcatttcg
cacatggataactgtgtgctgtatggtgatgtggcttttttaccgaaatggccgggtgtt
ccggtgggtaacgaagaaggtgggttgattgccgaggcattgggtagtaaacgcgcattg
atgcttgctcatcacggactgctggtggcttgcagtaatgttgaggaagcctgtttgatc
gcgctggcatttgagcgggctgcacgcatgcagttgctggcaagtgcggttggcgaaatt
cagccgatcgatccgacgctgggacgagaggcgcatgactggattttacatgcgcaacgc
agtgcgagcgcctttgcctattacgcccgacgttctctgaaacattgttctgattgtctg
tga

DBGET integrated database retrieval system