KEGG   Nitrosomonas eutropha: Neut_0220Help
Entry
Neut_0220         CDS       T00393                                 

Definition
(RefSeq) succinyl-CoA synthetase subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
net  Nitrosomonas eutropha
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Neut_0220
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Neut_0220
   00640 Propanoate metabolism
    Neut_0220
   00660 C5-Branched dibasic acid metabolism
    Neut_0220
Enzymes [BR:net01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Neut_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
227300..228493
Genome map
AA seq 397 aa AA seqDB search
MKIHEYQAKAILSRYAISVPAGIACFSVEEAILAAEKLGGDKWVVKAQIYAGGRGKAGGV
KLAKSIVEVRQFSEAMLFAPLVTHQTGPQGQIVRRLYIEQGIDISHEYYVALVVDRASQC
VSLIASDAGGMDIEGVATSTPEKIHKTQINPLEGLNLQDAERVVRQINLPESCRSAAVSM
LGALYQAFDENDISLLEINPLIVTPDNRLIALDAKMNFDDNALFRHPEIVALRDLDEDDP
LEVEAARHGLSYIPLDGDIGCLVNGAGLAMATMDIIKLYGGNPANFLDVGGGATVEKVTE
AFKLMLRNPDLQAILVNIFGGIMRCDVIADGVVSAVREVKLAVPLIVRLEGTNVELGKKI
LADSGLTIIAGSNMADAARKAVDAAARHRSEAATRGA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgaataccaggctaaagcaattcttagccgttatgcgattagtgtgccg
gccggtattgcttgttttagcgtggaggaagcgattctggctgctgaaaagctggggggt
gataaatgggtggtcaaggcacaaatttatgctggagggcgtggcaaggcagggggggta
aagctggcaaagtccattgtggaggtccggcagttttctgaggcgatgttgtttgctccg
ctggtcacgcatcaaaccggcccacagggacagattgttcgccggctctatattgaacag
gggatcgatatcagtcatgagtattacgtggcactggttgttgatcgtgcttcgcagtgt
gtcagtttaattgcgagtgatgcgggtggcatggatattgagggggtggcaaccagtaca
ccagaaaaaatacataaaactcagattaatccgcttgagggattgaatcttcaagatgca
gagagagttgtgcgccagatcaatttgcctgaatcatgccgatcagcggcggtgtctatg
ctgggggcgctatatcaggcattcgatgagaacgatatttcattacttgaaatcaatccg
ttgattgttacaccagataaccgtctgattgctttggacgccaaaatgaatttcgatgat
aacgccttgtttcgtcatccggaaatcgttgccctgcgggatctggatgaagatgatccg
cttgaggttgaagcagcgcggcatgggctttcctatattccgcttgatggtgatattggc
tgtctagtcaacggtgctggtttggctatggcaaccatggacattattaaactctatggt
ggcaatccagccaattttctggatgtgggaggcggagcgacggtggaaaaagtaactgag
gcattcaagctgatgctgagaaatcccgatttgcaggcaatactggtcaatatttttggt
gggattatgcgctgcgatgtaattgctgatggggtggtgtcagcggtgcgcgaggtgaag
ctagctgttccattgattgttcgattggagggaaccaatgtggagttggggaaaaagatt
ctggcagattcgggattaacgattattgctggcagcaacatggctgatgctgccagaaag
gcggtggatgcagcagctcggcatcgatctgaagctgcaaccagaggagcataa

DBGET integrated database retrieval system