KEGG   Nitrosomonas eutropha: Neut_0220Help
Entry
Neut_0220         CDS       T00393                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
net  Nitrosomonas eutropha
Pathway
net00020  Citrate cycle (TCA cycle)
net00640  Propanoate metabolism
net00660  C5-Branched dibasic acid metabolism
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
net01130  Biosynthesis of antibiotics
net01200  Carbon metabolism
Module
net_M00009  Citrate cycle (TCA cycle, Krebs cycle)
net_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Neut_0220
   00640 Propanoate metabolism
    Neut_0220
   00660 C5-Branched dibasic acid metabolism
    Neut_0220
Enzymes [BR:net01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Neut_0220
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 DUF2496
Motif
Other DBs
NCBI-ProteinID: ABI58505
JGI: Neut0220
UniProt: Q0AJG6
Position
227300..228493
Genome map
AA seq 397 aa AA seqDB search
MKIHEYQAKAILSRYAISVPAGIACFSVEEAILAAEKLGGDKWVVKAQIYAGGRGKAGGV
KLAKSIVEVRQFSEAMLFAPLVTHQTGPQGQIVRRLYIEQGIDISHEYYVALVVDRASQC
VSLIASDAGGMDIEGVATSTPEKIHKTQINPLEGLNLQDAERVVRQINLPESCRSAAVSM
LGALYQAFDENDISLLEINPLIVTPDNRLIALDAKMNFDDNALFRHPEIVALRDLDEDDP
LEVEAARHGLSYIPLDGDIGCLVNGAGLAMATMDIIKLYGGNPANFLDVGGGATVEKVTE
AFKLMLRNPDLQAILVNIFGGIMRCDVIADGVVSAVREVKLAVPLIVRLEGTNVELGKKI
LADSGLTIIAGSNMADAARKAVDAAARHRSEAATRGA
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgaataccaggctaaagcaattcttagccgttatgcgattagtgtgccg
gccggtattgcttgttttagcgtggaggaagcgattctggctgctgaaaagctggggggt
gataaatgggtggtcaaggcacaaatttatgctggagggcgtggcaaggcagggggggta
aagctggcaaagtccattgtggaggtccggcagttttctgaggcgatgttgtttgctccg
ctggtcacgcatcaaaccggcccacagggacagattgttcgccggctctatattgaacag
gggatcgatatcagtcatgagtattacgtggcactggttgttgatcgtgcttcgcagtgt
gtcagtttaattgcgagtgatgcgggtggcatggatattgagggggtggcaaccagtaca
ccagaaaaaatacataaaactcagattaatccgcttgagggattgaatcttcaagatgca
gagagagttgtgcgccagatcaatttgcctgaatcatgccgatcagcggcggtgtctatg
ctgggggcgctatatcaggcattcgatgagaacgatatttcattacttgaaatcaatccg
ttgattgttacaccagataaccgtctgattgctttggacgccaaaatgaatttcgatgat
aacgccttgtttcgtcatccggaaatcgttgccctgcgggatctggatgaagatgatccg
cttgaggttgaagcagcgcggcatgggctttcctatattccgcttgatggtgatattggc
tgtctagtcaacggtgctggtttggctatggcaaccatggacattattaaactctatggt
ggcaatccagccaattttctggatgtgggaggcggagcgacggtggaaaaagtaactgag
gcattcaagctgatgctgagaaatcccgatttgcaggcaatactggtcaatatttttggt
gggattatgcgctgcgatgtaattgctgatggggtggtgtcagcggtgcgcgaggtgaag
ctagctgttccattgattgttcgattggagggaaccaatgtggagttggggaaaaagatt
ctggcagattcgggattaacgattattgctggcagcaacatggctgatgctgccagaaag
gcggtggatgcagcagctcggcatcgatctgaagctgcaaccagaggagcataa

DBGET integrated database retrieval system