KEGG   Nitrosomonas eutropha: Neut_0427Help
Entry
Neut_0427         CDS       T00393                                 

Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
net  Nitrosomonas eutropha
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Neut_0427
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Neut_0427
   00052 Galactose metabolism
    Neut_0427
   00500 Starch and sucrose metabolism
    Neut_0427
   00520 Amino sugar and nucleotide sugar metabolism
    Neut_0427
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Neut_0427
   00524 Butirosin and neomycin biosynthesis
    Neut_0427
Enzymes [BR:net01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Neut_0427
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
443032..444039
Genome map
AA seq 335 aa AA seqDB search
MDQYLLYGDIGGTKTLLRSAVIKNEEVELHYEHRYDSRQYGDFDSILEDFLKQSDCQPVA
VCLAVAGPIVDQQVRLTNLPWTINASALAEKFSISAVKIVNDFEGMAASIEVLPQDDLVM
LQAGEPSSSAMRVVLGAGTGMGVAWLIKRGRFYEPLATEAGHVDFAPTSAIQIELLRYLM
TKYQRVSIERLLSGQGLTHIFNFLQADAAAGAHLKSIELDADDGATVTRLAFEHQYPIAL
KALDLFAEIYGAYAGNLALTGLCRGGVYIAGGIAPRIIQILQQPGFIQAFCNKGRYSELV
REIPVYVVMNPKAGLLGAGLLAQRMLHQSTISLAE
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atggatcaatatctattatatggcgacattggtggaaccaaaaccttgttgcgctctgct
gtgatcaagaatgaggaagttgagcttcattatgagcatcgttacgatagtcgtcagtac
ggtgattttgacagtattctggaagatttcttaaagcaatctgactgtcagccggttgct
gtctgtctggcagtcgccgggccgattgttgatcaacaggtgcgcctgaccaatttgccc
tggacaatcaatgcctccgcccttgcggaaaaattttcaatttctgctgtgaaaattgtc
aatgattttgaggggatggcagcttctatcgaagtactgccgcaggatgatctggttatg
ctgcaagccggggaaccttcttcttctgcgatgcgtgttgtactgggggcgggtaccggg
atgggagttgcttggttgatcaagcgtggacgattttacgaaccgcttgccaccgaagca
ggtcatgttgattttgcaccgaccagcgccattcagattgaattgctcagatatctgatg
acaaagtatcagagggtttcaattgaacgattgctttctggtcagggattgactcacatt
tttaattttttgcaagctgatgcggcagctggcgctcacttgaaaagtattgaactggat
gctgatgatggcgcaaccgttactcggctggctttcgagcaccaatatccgattgctcta
aaagcgcttgatctgtttgccgagatttatggtgcttatgcaggcaatctggcgctgaca
gggttatgccggggtggcgtctatattgcaggcggcatcgcgccgcgcattatccaaatt
ttgcaacaacccggttttatccaggcattctgcaacaaagggcgatacagtgaactggtg
cgcgagattccggtttatgtggtgatgaatccgaaagctggtttgctgggtgccgggttg
ctcgcacagcgcatgctgcatcagtcaacgatatctcttgcggaataa

DBGET integrated database retrieval system