KEGG   Nitrosomonas eutropha: Neut_0600Help
Entry
Neut_0600         CDS       T00393                                 

Definition
DNA polymerase III chi subunit, HolC
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
net  Nitrosomonas eutropha
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Neut_0600
   00240 Pyrimidine metabolism
    Neut_0600
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Neut_0600
   03430 Mismatch repair
    Neut_0600
   03440 Homologous recombination
    Neut_0600
Enzymes [BR:net01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Neut_0600
DNA replication proteins [BR:net03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Neut_0600
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
608214..608642
Genome map
AA seq 142 aa AA seqDB search
MTQIDFYTGATDRLLIACRLCSKAVQQGLKTVVYIPDAELANRFDKLLWTFSPTSFVPHC
QADDKLAGVTPVILNNQLEMPEVAYFDVLLNLDAAIPSGFEHFKRVVEIVDEIEDSKLHA
RKRYRRYQELGHDIRHHRLEEN
NT seq 429 nt NT seq  +upstreamnt  +downstreamnt
gtgacacagattgatttttacacgggcgcaaccgacagattgctgatcgcctgtcgtttg
tgttcgaaagcagtacagcagggattgaaaacagttgtttatattccggatgcagaattg
gcaaaccggtttgataagttgctctggacgttttctccaaccagttttgtcccacactgc
caggcagatgacaaactggcgggggtgacgccagtgatcctgaataatcagctagaaatg
ccggaagtggcttacttcgatgtgttgcttaatctggatgcggcaattccatccggattt
gaacattttaagcgggtcgttgaaattgttgatgaaatagaggacagcaagctgcatgca
cgcaaacggtaccggcgctaccaagagttgggacacgacattcgccatcatcggcttgag
gaaaattaa

DBGET integrated database retrieval system