KEGG   Nitrosomonas eutropha: Neut_0614Help
Entry
Neut_0614         CDS       T00393                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
net  Nitrosomonas eutropha
Pathway
net00230  Purine metabolism
net01100  Metabolic pathways
Module
net_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Neut_0614
Enzymes [BR:net01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Neut_0614
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_22 AAA_18 AAA_33 MMR_HSR1 AAA_28 AAA_16 Viral_helicase1 cobW AAA_23
Motif
Other DBs
NCBI-ProteinID: ABI58886
JGI: Neut0614
UniProt: Q0AD40
Position
complement(624404..625009)
Genome map
AA seq 201 aa AA seqDB search
MSCLFVISAPSGAGKTSVIRTLLQTDINVTLSVSYTTRPPRRDEENGRDYFFVDHATFRE
MQAHGEFLESAEVYGNFYGTSRKWIEETMVAEQDVLLEIDCQGAQQVRELYPQAASIFIL
PPSMETLKNRLEQRGLDESKTIERRLSAACSETSHLNRFDYVVVNHELETAAQEISCIIR
AERLKTIRQLVRQRALLAEFS
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgagttgtctgtttgtaatcagcgcaccctctggtgccggtaaaaccagtgtaatccgt
actttgctgcaaacggatatcaatgtaaccctctcagtttcctataccacacgccccccc
aggcgggatgaagagaacggtcgtgattacttttttgttgatcacgcaactttcagggaa
atgcaggcacatggtgaattcctggaaagcgccgaggtgtatggcaatttttatggcacc
tcacgcaagtggatagaagaaaccatggtggcggaacaggatgtcctgctggaaatagat
tgtcagggggcgcaacaggtgcgcgaactctacccgcaggctgcttccatatttattctg
cctccatccatggaaacattaaaaaaccgtctggagcaacgcggcctggatgaaagcaag
accattgaacggcggttgtcggctgcgtgcagcgagaccagccatctcaatagatttgac
tatgtcgttgttaatcacgaactggagacagcagcacaggaaatctcctgcattattcgg
gctgaacggctgaaaacaatccgtcagcttgtcaggcagcgcgctctgcttgctgaattt
tcctga

DBGET integrated database retrieval system