KEGG   Nitrosomonas eutropha: Neut_0779Help
Entry
Neut_0779         CDS       T00393                                 

Definition
fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
net  Nitrosomonas eutropha
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Neut_0779
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Neut_0779
Enzymes [BR:net01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Neut_0779
Lipid biosynthesis proteins [BR:net01004]
 Desaturase
  First
   Neut_0779
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
797661..798848
Genome map
AA seq 395 aa AA seqDB search
MDIASVLLTGLIDLPWWGYIIVTLVFTHITIASITIFLHRHQAHRALDLHPIPSHFFRFW
LWLSSGMVTKEWAAIHRKHHAKCETVDDPHSPQIFGIRKVLSEGAELYKIEAKNQETLDR
YGHGTPDDWMERNVYSKHSVAGIALMLIINVVLFGPIGLSIWAVQMMWTPVFAAGVINGI
GHYWGYRNFRPGDASRNISPWGILIGGEELHNNHHAYPTSARLSNKWYEFDIGWMYIRIL
EMMGLAKVKKTAPKLQLNKAKTQCDLETLQAVISHRYEVLAKYTKSLKIAFKNELSSLQQ
AAVELGVDGSTLKNWILADAKTLKEEERTKLDQVLSHTQKLDTLYRMREELSAIWERSAA
TKDELLKQLEDWCRRAEESGIELLENFSRRLRCYA
NT seq 1188 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgcatcggtattgttaactggacttattgatctgccgtggtggggatatatt
attgtgacactggtgtttacccacataacgattgccagtattactatctttttgcatcgt
catcaggcacatcgggcattggatttgcaccccatacctagccattttttccgtttctgg
ctgtggttatcgtctgggatggtaactaaggagtgggcggcaatccatcggaagcatcat
gcaaaatgtgaaactgtggatgatcctcacagtccgcaaatttttgggattagaaaggta
ttgagtgaaggagcagagctctacaagatcgaggccaaaaatcaggaaacacttgatcgc
tacgggcatggtaccccggatgattggatggagcgtaatgtgtattccaaacatagtgtg
gcaggtatcgcattaatgctaatcatcaatgtggtattgttcggtccgatcggtttatcg
atctgggctgtacaaatgatgtggacaccggtatttgcagcgggtgtcatcaacggcatt
ggccactactggggttatcgcaatttccgtcctggggatgcgagtcgcaatattagccca
tgggggatattgattggtggggaagagttgcataataatcaccatgcctacccaacctct
gccagattgtccaacaagtggtatgagtttgatatcggttggatgtatatccgcatactg
gaaatgatgggattggcgaaggtgaaaaaaacagctcccaagctgcaacttaataaagcc
aaaacccagtgtgatctggagacattgcaggcggttatttcccatcgatatgaggtgtta
gcgaaatataccaaatcattgaaaattgcattcaagaatgagctgtcatctttacagcaa
gcagcggttgagcttggtgtagatggctcaactctgaaaaactggatactggctgatgcg
aaaaccttgaaggaagaggaacgtaccaagctggatcaggtgttgagccatactcagaag
ctggatacgctttatcgtatgagagaagagctgtctgcgatatgggaacggtcagcggca
accaaggatgagttgctcaagcaacttgaagactggtgtcggcgcgcagaagaaagtggt
attgagctgctggagaatttttcacgcagactaagatgctatgcataa

DBGET integrated database retrieval system