KEGG   Nitrosomonas eutropha: Neut_0787Help
Entry
Neut_0787         CDS       T00393                                 

Definition
6-phosphofructokinase (EC:2.7.1.11)
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
net  Nitrosomonas eutropha
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
RNA degradation
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Neut_0787
   01230 Biosynthesis of amino acids
    Neut_0787
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Neut_0787
   00030 Pentose phosphate pathway
    Neut_0787
   00051 Fructose and mannose metabolism
    Neut_0787
   00052 Galactose metabolism
    Neut_0787
  Energy metabolism
   00680 Methane metabolism
    Neut_0787
 Genetic Information Processing
  Folding, sorting and degradation
   03018 RNA degradation
    Neut_0787
Enzymes [BR:net01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Neut_0787
Protein phosphatases and associated proteins [BR:net01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     Neut_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(804906..806165)
Genome map
AA seq 419 aa AA seqDB search
MTIKNAFYAQSGGVTAVINASAAGLLETARAHPDKIGNVYAGRNGIIGALTEDLIDTGAE
PLEAIRALRHTPSGAFGSCRYKLKSLEDNRREYERLIKIFKAHNIGYFFYNGGGDSADTC
LKVSQLADTLGYPIQAIHIPKTVDNDLPVTDCCPGFGSVAKYVAVSMLEASFDVASMAKT
STKVFILEVMGRHAGWIAAAGGLASSKDRHVPIIILFPEVTFDEEKFLAKTDRYVKEYGY
CTVVVSEGVKGADGKFLSDQGLRDAFGHAQLGGVAPVIANMVRNGLGLKYHWGVSDYLQR
AARHIASRTDVEQAYATGKAAVEYAIAGYNSVMPTIERISNSPYTWKIGMVELSKVANVE
KMMPADFISEDGFGITDKCREYLSPLIEGEDYPPYKNGLPDYIRLKNTAVAKKLAEFKI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgactataaaaaatgcattctatgcccaatctggcggtgtaacggctgtaatcaatgct
tcagcggcaggtttactggaaacagcacgtgcacacccggataaaattggaaacgtttat
gccggtcgcaatggcattatcggggcactcactgaagacttaattgataccggcgcagag
cccctcgaagcaatccgggcattgcgccacacaccatccggcgcttttggctcctgtcgc
tacaaactgaaaagccttgaagataaccgacgggaatacgaacgtctgataaaaatattc
aaggcccataatatcggctactttttctataacggtggcggcgattcggccgatacctgc
ctaaaagtctcacagctggccgatacactcggctatccaatccaggcaattcacataccc
aagacagttgacaatgatctgcccgtcacggattgttgcccagggtttggttcagttgcc
aaatatgtagctgtttccatgctggaagccagttttgatgtcgccagtatggccaagact
tcaaccaaagtgttcattctggaagtgatggggcgtcatgctggatggattgcagccgca
ggcgggttggcgtccagcaaggatcgtcatgtcccaattatcatcctgtttccagaagtt
acattcgatgaagagaaattcttggccaaaacggatcgttacgtcaaggaatacggttat
tgtacggtggtggtatcagagggagtgaaaggagctgacggcaaatttctgtccgatcag
ggattgcgcgatgcgtttggacatgcgcagctgggtggtgtggcgccagtaatcgcaaat
atggtcagaaatggcctgggattaaaatatcattggggagtctcggattatctgcagcgt
gctgcccggcatattgcttcccgaacagacgtggagcaagcctacgccacaggcaaagct
gccgtggaatatgcaattgccggatacaattcggtgatgccgactatcgaacgcatctcc
aattcgccctatacctggaaaatcggtatggttgaactttccaaagttgccaatgtagaa
aaaatgatgccagcagactttatcagtgaagatggctttggcattaccgacaaatgccgc
gaatatctcagccctttaatcgagggggaagactatccaccctacaagaatggactgccc
gactatattcggcttaaaaatacggcagttgctaaaaagctggctgagttcaaaatttaa

DBGET integrated database retrieval system