KEGG   Nitrosomonas eutropha: Neut_0787Help
Entry
Neut_0787         CDS       T00393                                 

Definition
(GenBank) pyrophosphate-dependent phosphofructokinase
  KO
K21071  ATP-dependent phosphofructokinase / diphosphate-dependent phosphofructokinase [EC:2.7.1.11 2.7.1.90]
Organism
net  Nitrosomonas eutropha
Pathway
net00010  Glycolysis / Gluconeogenesis
net00030  Pentose phosphate pathway
net00051  Fructose and mannose metabolism
net00052  Galactose metabolism
net00680  Methane metabolism
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
net01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Neut_0787
   00030 Pentose phosphate pathway
    Neut_0787
   00051 Fructose and mannose metabolism
    Neut_0787
   00052 Galactose metabolism
    Neut_0787
  Energy metabolism
   00680 Methane metabolism
    Neut_0787
Enzymes [BR:net01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Neut_0787
    2.7.1.90  diphosphate---fructose-6-phosphate 1-phosphotransferase
     Neut_0787
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-ProteinID: ABI59057
JGI: Neut0787
UniProt: Q0AHX5
Position
complement(804906..806165)
Genome map
AA seq 419 aa AA seqDB search
MTIKNAFYAQSGGVTAVINASAAGLLETARAHPDKIGNVYAGRNGIIGALTEDLIDTGAE
PLEAIRALRHTPSGAFGSCRYKLKSLEDNRREYERLIKIFKAHNIGYFFYNGGGDSADTC
LKVSQLADTLGYPIQAIHIPKTVDNDLPVTDCCPGFGSVAKYVAVSMLEASFDVASMAKT
STKVFILEVMGRHAGWIAAAGGLASSKDRHVPIIILFPEVTFDEEKFLAKTDRYVKEYGY
CTVVVSEGVKGADGKFLSDQGLRDAFGHAQLGGVAPVIANMVRNGLGLKYHWGVSDYLQR
AARHIASRTDVEQAYATGKAAVEYAIAGYNSVMPTIERISNSPYTWKIGMVELSKVANVE
KMMPADFISEDGFGITDKCREYLSPLIEGEDYPPYKNGLPDYIRLKNTAVAKKLAEFKI
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgactataaaaaatgcattctatgcccaatctggcggtgtaacggctgtaatcaatgct
tcagcggcaggtttactggaaacagcacgtgcacacccggataaaattggaaacgtttat
gccggtcgcaatggcattatcggggcactcactgaagacttaattgataccggcgcagag
cccctcgaagcaatccgggcattgcgccacacaccatccggcgcttttggctcctgtcgc
tacaaactgaaaagccttgaagataaccgacgggaatacgaacgtctgataaaaatattc
aaggcccataatatcggctactttttctataacggtggcggcgattcggccgatacctgc
ctaaaagtctcacagctggccgatacactcggctatccaatccaggcaattcacataccc
aagacagttgacaatgatctgcccgtcacggattgttgcccagggtttggttcagttgcc
aaatatgtagctgtttccatgctggaagccagttttgatgtcgccagtatggccaagact
tcaaccaaagtgttcattctggaagtgatggggcgtcatgctggatggattgcagccgca
ggcgggttggcgtccagcaaggatcgtcatgtcccaattatcatcctgtttccagaagtt
acattcgatgaagagaaattcttggccaaaacggatcgttacgtcaaggaatacggttat
tgtacggtggtggtatcagagggagtgaaaggagctgacggcaaatttctgtccgatcag
ggattgcgcgatgcgtttggacatgcgcagctgggtggtgtggcgccagtaatcgcaaat
atggtcagaaatggcctgggattaaaatatcattggggagtctcggattatctgcagcgt
gctgcccggcatattgcttcccgaacagacgtggagcaagcctacgccacaggcaaagct
gccgtggaatatgcaattgccggatacaattcggtgatgccgactatcgaacgcatctcc
aattcgccctatacctggaaaatcggtatggttgaactttccaaagttgccaatgtagaa
aaaatgatgccagcagactttatcagtgaagatggctttggcattaccgacaaatgccgc
gaatatctcagccctttaatcgagggggaagactatccaccctacaagaatggactgccc
gactatattcggcttaaaaatacggcagttgctaaaaagctggctgagttcaaaatttaa

DBGET integrated database retrieval system