KEGG   Nitrosomonas eutropha: Neut_0859Help
Entry
Neut_0859         CDS       T00393                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase E2 component
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
net  Nitrosomonas eutropha
Pathway
net00020  Citrate cycle (TCA cycle)
net00310  Lysine degradation
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
net01130  Biosynthesis of antibiotics
net01200  Carbon metabolism
Module
net_M00009  Citrate cycle (TCA cycle, Krebs cycle)
net_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Neut_0859
  Amino acid metabolism
   00310 Lysine degradation
    Neut_0859
Enzymes [BR:net01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Neut_0859
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N GCV_H Presenilin
Motif
Other DBs
NCBI-ProteinID: ABI59122
JGI: Neut0859
UniProt: Q0AHR0
Position
complement(874659..875951)
Genome map
AA seq 430 aa AA seqDB search
MLIEVKVPVFSESVTEGTLINWLKKQGEHIERGENLIDIETDKVVLELPAPQSGVLVEIV
KNDGAIVTSGEIIARIDTAAKGLKTDPQQPAQTAQAESVDDPKQPAADKTDDVSPQPGRP
LMPAAKRVADENGLTAKEITAIHGTGRGERITKEDVLNHIKNRESSATSQQPDSSSNQPV
RKIQPDTASSASQTEQSARQEKRVPMTRLRMRIAERLVQSQSTAAILTTFNEVNMQAILD
LRARYRVSFEKEHGIKLGFTSFFIKAAIAALKKFPIINASVDGNDIIYHEYYDIGIAVAS
PRGLVVPIIRDADKLTFAEIERQIADLAKRAQDGKLTIEELTGGTFSITNGGVFGSMLST
PIINPPQSAILGIHATKERPVVENGQIVIRPMNYLALSYDHRIIDGREAVLSLVAMKEAL
EYPASPLFDD
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcgaagtcaaagtccccgtattttcagaatcagtgacagaaggtacgctgatc
aattggcttaaaaaacagggagaacatattgaacgcggtgaaaatctgattgatattgaa
acagataaggtggttctggagctccctgccccgcaatccggtgttctggttgaaatcgtc
aaaaatgatggggctatcgtcaccagcggggaaatcatcgctcgtatcgacactgcagca
aaaggcttgaaaacagatccacagcaacctgcacaaaccgctcaggctgaatctgttgac
gatcccaaacagccagcagctgataagaccgacgacgtatcaccacaaccaggccgcccg
cttatgccggctgcaaaaagagtcgcagacgagaatggtctgactgccaaggaaataaca
gccatacatggcaccggccgtggtgaacgaattaccaaggaagatgtattaaaccacatc
aagaatcgagaaagctctgccactagccaacaaccagattcctcatcgaatcagcctgtc
agaaaaattcagcctgacacagcctcatcagcctctcaaacagaacaatccgcaagacaa
gaaaaacgtgtgcccatgacccgtctacgcatgcgtattgcagaacggctggtacagtcc
caatccaccgcagctattctgacgacattcaatgaagtcaacatgcaggccattctggat
ttacgtgcccgttacagggtcagttttgagaaagaacacggcatcaaactcgggtttacc
tcattcttcattaaggcagctatcgcagcacttaaaaaattccccatcatcaacgcatcg
gtggatggaaacgacatcatctatcacgaatattacgacatcggcatagccgtagccagc
ccgcgcggcctggttgtgcccattattcgcgatgcagacaaacttacctttgctgaaatt
gaaagacagattgctgatctggctaaacgagcgcaggatggaaaactgaccatagaagag
ctaacgggaggcaccttttctattaccaacggcggtgtcttcggatcaatgctctccacg
ccgatcatcaatccgccacaaagtgctattcttggtatccatgccactaaagagcgcccg
gtagttgaaaatggtcagatcgtcattcggcccatgaactacctcgcgctttcctatgat
caccgcattatcgatgggcgtgaagccgtgctatcactggtagccatgaaggaagcactg
gaatacccggccagcccgctgttcgatgattga

DBGET integrated database retrieval system