KEGG   Nitrosomonas eutropha: Neut_0920Help
Entry
Neut_0920         CDS       T00393                                 

Gene name
tpiA
Definition
triosephosphate isomerase (EC:5.3.1.1)
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
net  Nitrosomonas eutropha
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Class
Metabolism; Overview; Carbon metabolism [PATH:net01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:net01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:net00010]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:net00051]
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:net00562]
Metabolism; Energy metabolism; Carbon fixation in photosynthetic organisms [PATH:net00710]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
947356..948114
Genome map
AA seq 252 aa AA seqDB search
MTRAGFVAGNWKMYGNLVQNQELLAAIVLGIPSLQNASCAVCVPYPYLAQAQSVLKGTHV
AWGGQNISQHHQGAYTGEVSAGMLTDFGCRYVIVGHSERRTLYGEDNQMVAEKFHSAQEQ
SLVPILCVGETLAQREANETEQVIARQLDAVIGLVGVNAIKQSVIAYEPVWAIGTGETAT
PQQAQDVHAFVRNRIAAHNSEIAADIQIVYGGSVKANNASELFAMPDIDGGLIGGASLVA
AEFISICFAAQS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtgcggggtttgtggcgggaaactggaaaatgtatggtaatttggttcagaat
caagaattgcttgccgcaattgttttgggtatcccatcattgcagaatgcgtcctgcgcg
gtatgtgtgccttatccctacttggcgcaagcgcagtcagtgttgaagggtacgcatgtg
gcatggggggggcagaatatcagccagcatcatcaaggtgcttataccggagaggtatcg
gcaggtatgctgaccgattttggttgtcgttatgtaattgtgggccactcggagcggcgg
acgctatacggtgaagataatcagatggttgcggagaaatttcactccgcccaggagcaa
tcgctagtaccaatactctgtgtcggcgaaacgctggcgcagcgtgaggcaaatgagacc
gaacaagtgatagctaggcagcttgatgcggtgattggtctggtaggtgttaatgcgata
aagcaatcagttattgcatatgagccggtatgggcaattggtacaggagaaactgctact
ccccagcaggcgcaggatgttcatgcatttgtaaggaatcgaatagctgctcataacagc
gaaattgcagcagatatccagatagtttatggcggaagtgtgaaagcaaataatgcgtct
gaattatttgcgatgcctgacattgacggagggttgattgggggagcttcgttagttgct
gcagagtttatttcgatttgtttcgcagcgcaaagttga

DBGET integrated database retrieval system