KEGG   Nitrosomonas eutropha: Neut_0920Help
Entry
Neut_0920         CDS       T00393                                 

Definition
(GenBank) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
net  Nitrosomonas eutropha
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Carbon fixation in photosynthetic organisms
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Neut_0920
   01230 Biosynthesis of amino acids
    Neut_0920
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Neut_0920
   00051 Fructose and mannose metabolism
    Neut_0920
   00562 Inositol phosphate metabolism
    Neut_0920
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    Neut_0920
Enzymes [BR:net01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Neut_0920
Exosome [BR:net04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Neut_0920
  Exosomal proteins of bladder cancer cells
   Neut_0920
  Exosomal proteins of melanoma cells
   Neut_0920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
947356..948114
Genome map
AA seq 252 aa AA seqDB search
MTRAGFVAGNWKMYGNLVQNQELLAAIVLGIPSLQNASCAVCVPYPYLAQAQSVLKGTHV
AWGGQNISQHHQGAYTGEVSAGMLTDFGCRYVIVGHSERRTLYGEDNQMVAEKFHSAQEQ
SLVPILCVGETLAQREANETEQVIARQLDAVIGLVGVNAIKQSVIAYEPVWAIGTGETAT
PQQAQDVHAFVRNRIAAHNSEIAADIQIVYGGSVKANNASELFAMPDIDGGLIGGASLVA
AEFISICFAAQS
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgacgcgtgcggggtttgtggcgggaaactggaaaatgtatggtaatttggttcagaat
caagaattgcttgccgcaattgttttgggtatcccatcattgcagaatgcgtcctgcgcg
gtatgtgtgccttatccctacttggcgcaagcgcagtcagtgttgaagggtacgcatgtg
gcatggggggggcagaatatcagccagcatcatcaaggtgcttataccggagaggtatcg
gcaggtatgctgaccgattttggttgtcgttatgtaattgtgggccactcggagcggcgg
acgctatacggtgaagataatcagatggttgcggagaaatttcactccgcccaggagcaa
tcgctagtaccaatactctgtgtcggcgaaacgctggcgcagcgtgaggcaaatgagacc
gaacaagtgatagctaggcagcttgatgcggtgattggtctggtaggtgttaatgcgata
aagcaatcagttattgcatatgagccggtatgggcaattggtacaggagaaactgctact
ccccagcaggcgcaggatgttcatgcatttgtaaggaatcgaatagctgctcataacagc
gaaattgcagcagatatccagatagtttatggcggaagtgtgaaagcaaataatgcgtct
gaattatttgcgatgcctgacattgacggagggttgattgggggagcttcgttagttgct
gcagagtttatttcgatttgtttcgcagcgcaaagttga

DBGET integrated database retrieval system