KEGG   Nitrosomonas eutropha: Neut_1152Help
Entry
Neut_1152         CDS       T00393                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
net  Nitrosomonas eutropha
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Neut_1152
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Neut_1152
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Neut_1152
Enzymes [BR:net01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Neut_1152
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
1191925..1193124
Genome map
AA seq 399 aa AA seqDB search
MKMYDLPDKRGHFGPYGGTFVAETLISALDELCKQYEYYRGDAEFQTEFFRELKHYVGRP
SPIYHARRWSDHLGGAQILLKREDLNHTGAHKINNTVGQALLARRMGKSRIIAETGAGQH
GVASATVAARYGMECVVYMGSEDVKRQATNVYRMKLLGATVIPVDSGSRTLKDALNEAMR
DWVTNVGNTYYIIGTVAGPHPYPMMVRDFQAVIGNEARQQMQEEYGRQPDALIACVGGGS
NAIGLFYPYIGEENVRMIGVEAAGKGIDTQKHAATLVTGRPGVLHGNRTYLIQDENGQII
ETHSISAGLDYPGVGPEHAWLKDCGRAEYVAITDGEALAAFHALCRFEGIMPALESSHAL
AYAAKLAPTLRKDQLLLVNLSGRGDKDMATVAQQSGISL
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgtatgatcttcccgataaacgtggccattttggtccgtacggtggtacgttc
gtggctgaaaccctgatttcagccttggatgagctttgtaagcaatatgagtattatcgt
ggtgatgccgaatttcaaacggaattctttcgtgagcttaaacattatgttggccgcccc
agtcccatttatcatgccagacgttggtcggatcatctgggtggtgcacagattctactg
aagcgtgaagatcttaaccatacaggtgcacataaaattaacaatacggttggccaggcg
ttgcttgcaaggcgtatggggaaaagtcgtatcatcgctgaaacgggtgccggtcagcat
ggagtagccagtgccactgtggccgcccgctatggtatggaatgtgtcgtgtacatgggt
tccgaggatgtcaagcgacaggcaaccaatgtttatcgtatgaagttgcttggggccaca
gtcataccggttgattcaggttcgcgcacacttaaagatgcattgaatgaagccatgcgt
gactgggtgaccaatgttggtaacacctactatattattggtactgttgcgggaccgcat
ccttatccgatgatggtcagggattttcaggcggtaatcgggaatgaagccaggcaacag
atgcaggaagaatatggtagacaaccagatgctctgattgcatgtgtaggcggcggttca
aatgccattggcctgttttatccttatattggggaagaaaacgttcgaatgattggtgta
gaagccgcgggcaagggaatcgatacgcagaaacatgctgccaccctggtaacgggcagg
ccgggtgttttacatggtaatcgtacctatctgattcaggatgaaaatggccagatcatc
gaaacacattcaatttctgctggcctggattacccgggagtaggaccggagcatgcatgg
cttaaggactgcggtcgtgccgaatatgtcgctataacagatggtgaggctttggctgca
tttcatgctttatgtcgcttcgaagggatcatgccggctttggaatccagccacgctctg
gcttatgcagccaaacttgcgccaacactgagaaaagatcagctcctcctggtgaacctg
tcaggtcgcggggacaaggatatggcaacagtggcacagcaatcaggtatttcgctttaa

DBGET integrated database retrieval system