KEGG   Nitrosomonas eutropha: Neut_1173Help
Entry
Neut_1173         CDS       T00393                                 

Definition
chemotaxis-specific methylesterase (EC:3.1.1.61)
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
net  Nitrosomonas eutropha
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:net00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Neut_1173
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Neut_1173
Enzymes [BR:net01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Neut_1173
Two-component system [BR:net02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Neut_1173
Bacterial motility proteins [BR:net02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Neut_1173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1223882..1224949
Genome map
AA seq 355 aa AA seqDB search
MKKISVLVIDDSALIRKLLAEIINSQSDMEVIGAAPDPLVAREMIRTLNPDVLTLDVEMP
KMDGLEFLEKLMRLRPMPVVMVSTLTECGSETTFRALELGAIDFVAKPKMDIRHGLEAYG
SEIASKIRIASTARIRRLEPGAAASGRALQIPRHHSISTEKLIIIGASTGGTEAIKDVLI
HFPPDCPGILIAQHMPEGFTRSFAERLDRLCRIRVTESEGGERVLPGHAYIAPGHSHLLL
KKSGANYITELSQADPVNRHRPSVDVLFQSAAQCAGKNAVGVILTGMGKDGAVGMLAMHH
AGAYNLAQDEASCVVFGMPREAIAVGATDEVVPLQDMASHILAKLTGTVRQAVRI
NT seq 1068 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatcagtgtgcttgttatcgatgattctgccttgattcgtaaattactggcc
gagatcatcaatagccaatcggatatggaagtaatcggggcagcaccggatccactggta
gcgcgtgaaatgatccggacattgaatccggatgtgctgacattggatgtggaaatgccc
aaaatggacgggctggaatttctggaaaaactgatgcggttgcggcccatgccggtagtg
atggtttctacgctgaccgaatgtggctcggaaacgactttccgcgcacttgaactaggc
gcaatcgattttgttgccaagcccaaaatggatattcgccatggcctcgaagcttatggt
agcgagattgccagcaaaattcgcattgccagcacagcacgtatccgtcgcctggagcct
ggcgctgctgcgagtggtagagctttacagattccgcgccatcatagtatctcaaccgaa
aagctgattattatcggtgcatctacgggcggtaccgaagccatcaaggatgtgctgatt
cattttccgccggattgtccaggtattctgattgcccagcacatgccggaaggatttacc
cgttctttcgctgaacggctggatcggctctgcagaatccgggtaacggaatccgaagga
ggggagcgtgttttaccgggccatgcctatattgcgccgggccattctcatctcctgctg
aaaaagagtggagccaattatattaccgagctgagtcaggcagatccggtcaaccgccat
cgcccatccgtggatgtactgtttcagtctgctgcacagtgcgctgggaagaatgcggtt
ggtgtgattctgacaggcatgggcaaggatggtgcagtaggaatgctggcaatgcatcat
gcaggtgcctataacctggcacaggatgaagccagttgcgtggtgttcggtatgccccgg
gaagcaattgctgttggtgcgactgatgaagtggtgcccttgcaggatatggcctcacac
atcctggcaaaactgactggtacagtcaggcaagctgttcgtatctga

DBGET integrated database retrieval system