KEGG   Nitrosomonas eutropha: Neut_1291Help
Entry
Neut_1291         CDS       T00393                                 

Definition
glycogen branching protein (EC:2.4.1.18)
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
net  Nitrosomonas eutropha
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Neut_1291
Enzymes [BR:net01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     Neut_1291
Exosome [BR:net04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Neut_1291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1352413..1354611)
Genome map
AA seq 732 aa AA seqDB search
MKSLPFPSPSRDLAGDSAQSLLLAARLHAPGSYLGIHSVPGGELVRVFQPYMSRVWLQTS
SGFQVMECTHDAGIFEWKGEAVTRPYLLRLEHAETGVIEERYDPYAFPVQISGHDLYLFN
EGRLLQAYHMLGTHQVKNQGVTGTRFAVWAPNAERVSVVGDFNHWDGRVCPMMARDHSGV
WELFIPDLPGGTLYKYEIRNHSTGEILLKTDPYATRYELRPNNAALTPVESRYEWQDNDW
MVQRAGWDWLHAPVNIYELHVGSWKRHPDGSFYSYQELADHLIPYLQEMGYSHVELLPIS
EHPLDESWGYQVTGYFAATSRYGNPEAFMYFVDKCHQAGIGVILDWVPAHFPQDSFSLAR
FDGTALYEHEDPRLGYHQDWGTYIFNYGRSEVKSFLLSSAHYWLSVFHIDGLRVDAVASM
LYLDYSRKEGEWLPNRFGGRENLDAIDFLRELNTMVHGEFSGALTFAEESTSWPAVSRPT
YLGGLGFSMKWNMGWMNDTLNYMQLDPIHRHYHHNELTFNQLYAYTENFILPLSHDEVVH
GKKSLLDKMSGDVWQMFANLRLLFTYQMTCPGKKINFMGNEFAQGREWRVNHELDWYLLE
RDPHRGIQMLLRNLNHLYLDTPALHELDFFTEGFSWIDCHDSEQSVISYQRRARDGSFML
VILNFTPVPRTGYRVGVPESRTYQEVFNSDSTYYGGSNIGNPGDIVPTGQQWSGQVDSII
ITLPPLAGIILI
NT seq 2199 nt NT seq  +upstreamnt  +downstreamnt
atgaaatctttgcctttcccatccccatcccgagatttagcaggtgattctgcgcaatca
ttgttattggccgcaaggctgcatgcccccggctcttatctggggatacattctgttccg
ggcggtgagctggttcgagtgtttcaaccgtatatgtcacgggtatggctgcagacttca
tccggtttccaggtgatggagtgcacgcacgatgcaggtattttcgagtggaagggggag
gctgttacgcgtccttatttactgcgtctggaacatgcagaaaccggggtaattgaggag
cgctatgatccttatgcttttccagtacagatttcaggacatgatctgtatctgttcaat
gaagggcgcctgctccaggcataccacatgctgggtacccatcaggtcaaaaatcaaggc
gttacgggcacacgttttgccgtatgggcacccaatgccgaacgggtaagtgtcgttggg
gatttcaatcactgggatggcagggtgtgccctatgatggcgcgtgatcacagcggggta
tgggaattgtttattccggatctgcccggaggtacgttatataaatatgagatcagaaat
cattcaactggagaaatcctgctcaagaccgatccttatgcaaccaggtatgaattgcgt
cccaataatgccgcattgacgccagttgaaagccggtatgaatggcaggataacgactgg
atggtgcaacgcgcaggatgggactggctacatgcgccagtcaatatttatgagctgcat
gtaggttcgtggaaacgccatccggatggcagcttctattcatatcaggaattagccgat
cacctgattccttatctacaagagatgggttattcccatgttgagctgttgccaatttcc
gagcacccgctggatgaatcctggggatatcaggtaacaggttattttgcagcaaccagc
cgctatggtaatccagaagcattcatgtattttgtggataaatgtcatcaggctggaatt
ggtgtgattctcgactgggtgccggcacattttccacaagacagtttttcattggcacgg
tttgacggtacagcgctctatgaacatgaagatccgcgcctgggttatcaccaggattgg
gggacgtatattttcaattacgggcgcagtgaggtgaaatcctttctgctttccagcgcc
cattactggttgtctgttttccatattgacgggctgcgtgtggatgcggtggcctcgatg
ctctatctggattattcgcgcaaagaaggagaatggctgcccaatcgttttggtgggcgt
gaaaatcttgatgcaattgatttcttgcgtgaattgaacacgatggtgcatggtgaattt
tccggtgcgcttacttttgccgaggaatccacctcctggccagcagtatctcgtccgacc
tatctgggcgggctgggtttttccatgaaatggaacatgggatggatgaacgatacgctg
aattacatgcaactggatccaattcaccggcattaccatcacaatgaactaacgttcaat
cagctttacgcctataccgaaaacttcattttgccgctttcgcatgatgaagtggtacat
ggcaaaaaatccctgctggacaagatgtcgggagatgtctggcaaatgtttgccaacctg
cgtttgctgtttacctaccagatgacctgcccaggcaaaaaaatcaactttatgggcaat
gaatttgctcaaggacgtgaatggcgggttaatcatgaacttgactggtatctgctggag
cgtgatccgcatcgtggtatacaaatgttattgcggaatctgaatcacctctacctggat
acaccagcgttgcatgagctggatttttttactgaaggattttcctggattgattgtcat
gattcggaacagtcagttatcagttaccagcgccgtgccagagatggatcattcatgctg
gtgatcctgaatttcacaccagtgccacgtaccggctaccgagtaggcgtaccggaatcc
cgaacataccaagaagtattcaacagcgattcaacttactatggtggcagcaatatcggt
aaccctggggatattgttccgaccgggcagcagtggtcaggtcaagttgattccatcatc
attaccttaccgccgctggcgggtatcattctgatttga

DBGET integrated database retrieval system