KEGG   Nitrosomonas eutropha: Neut_1294Help
Entry
Neut_1294         CDS       T00393                                 

Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
net  Nitrosomonas eutropha
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Neut_1294
Enzymes [BR:net01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Neut_1294
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1357884..1359908
Genome map
AA seq 674 aa AA seqDB search
MTSSVSLLFGVHAHQPIGNFPEVVIDAHERCYKPFLQTLYRYPEFRFAIHFSGWLLDFLF
EHYPKDMALLREMVTRGQIEIFGAGDTEPVLAAIPERDRIGQLKTFSAKLKKKLGQSPQG
AWLTERVWESTIVPALVNCGIHYVIVDDYHFICTGKNKIELDGYFSTEEDHHKLDLFPIS
EALRYRLPFSPALEAIAYIESLIDQSTTEHQPAAVYFDDIEKFGIWPETYQWVYEHGWLE
KFIQGVLASPHIQLQHYRDYHASEKTRGIVYLPTTSYIEMNEWTLPAEPAHIYDDLVQQA
KSTGQYEQTRSFLRGGMWKNFFSRYPESNWMHKRMLGLSARYASLPARQRTSAMQRCLYA
SQANDAYWHGLFGGLYLPHLRRTVYNNLIELEAQLDQCESRNIYYHEDTDLDGTEEIYLQ
NGTVQAVLKLNSSASICELDSYPLKHNFADTLARQTEHYYRKIQPGLQGASSHQQSGIAS
AHDRVNFKHAISQADMEPDLYAQHLFIDRLNGELLDYQLHPSDKADEVIFQAITDFGSIS
KCFRIISNQLLVIYVCSGEASGYMQTEINLAMPSCDGPGGRYIRNHTVLSGFGQPIELDN
LTAITLEDDTLGGSLSLDISPVTKFYACPHFTVSQSEGGFEKIMQAVKLILTWKITDDQQ
QHITLRFDEMNTTV
NT seq 2025 nt NT seq  +upstreamnt  +downstreamnt
atgacctcatccgtatcattgctgtttggtgtccacgcccaccaaccgattggcaatttc
cccgaggtcgttattgatgcgcatgaacgctgttacaagcccttcctgcaaactttatac
cgctatccggaatttcgttttgccatccacttttccggctggttgctggattttctattt
gagcactacccgaaagatatggcgttattacgtgagatggtcacacgcgggcagatcgaa
atatttggtgcaggcgataccgagccggtactggcggccattcccgagcgggatcgcatc
ggccagctcaagaccttttcggctaaactcaagaaaaagctggggcagtcgccacaaggc
gcctggctaactgagcgtgtatgggaatccactatcgtgcctgctttggttaattgcggt
atccattatgtaatagtggacgattaccacttcatttgtaccggaaaaaataaaatagaa
cttgatggttacttcagtactgaagaagatcatcacaagcttgatctttttcccatctcc
gaagcattgcgttaccggctccccttttctcctgcgctggaagccattgcctatattgaa
tccctgattgatcagtccacaaccgagcatcaacctgcagcagtctattttgacgacatt
gagaaattcggcatctggccagaaacttatcagtgggtttacgaacacggctggctggag
aaatttatccagggtgtactggcttctcctcatatccagctgcagcactaccgggattat
catgccagcgaaaaaacccgtggcatcgtttacctccccaccacctcctacatcgagatg
aatgaatggacgctgcccgctgaacctgctcatatttatgatgatctggtgcagcaagcc
aaatccacaggtcagtacgaacaaaccagatctttcctgcgcggaggaatgtggaaaaac
tttttttcacgctaccctgaatccaactggatgcacaagcgcatgctcggcctgtccgca
cgttacgccagcctgccggccaggcagcggacctctgccatgcaacgatgcctgtacgct
tcccaggccaatgatgcctactggcatggtctatttggcggtctgtatctgccgcatttg
cggcgcaccgtctacaacaatctgattgaactggaagcgcaactcgatcagtgtgaatcg
cgcaatatctactatcatgaggatactgatctggatggcacggaggaaatctatctgcaa
aacgggactgtgcaggcagttttgaaactcaacagcagcgccagcatctgcgaactggac
agctatccactgaaacacaactttgccgataccctcgcccgccagactgagcattactac
cgaaagatccaaccgggtctacagggagcttcatctcatcagcaatcaggaatagcttca
gcacatgatcgagtcaatttcaaacatgctattagccaggcagatatggaaccggatctg
tatgcacaacacctgtttattgatcgtttaaacggtgagctgctggattatcaactgcac
ccctcagataaggcagatgaagttatttttcaggcgataacagatttcgggtcaatcagt
aaatgctttcggattatcagcaaccagctacttgtcatctatgtatgcagcggggaagcc
agtggatacatgcagacagaaatcaatctggccatgcccagttgcgacggaccgggcgga
cgttacatccggaatcacactgtgctgtccggcttcggacaacccatcgaactggataat
ctgacagccattacactggaagacgacacgctgggcggcagtctgtcacttgatatttca
cctgtaacaaaattttatgcctgcccgcacttcaccgtttctcaatcggaaggcggattt
gaaaaaatcatgcaggcagtcaaactaatacttacctggaagataacggatgaccagcag
caacatattacccttcgttttgatgaaatgaacactactgtttga

DBGET integrated database retrieval system