KEGG   Nitrosomonas eutropha: Neut_1357Help
Entry
Neut_1357         CDS       T00393                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
net  Nitrosomonas eutropha
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:net00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Neut_1357
Enzymes [BR:net01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Neut_1357
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1427146..1429188
Genome map
AA seq 680 aa AA seqDB search
MSTPATNPQEILALLESWVTRGWLRELDLALVRFLKTEVPAMDPVLMLATALVSHQLGRG
HVCLDLDNLLSDPCTALSLPSGQNEPSARKEIQHISVLLADWKASGWLTQQTELISKDER
NTPLVLAGPRLYLRRYWRYERQVEAAIYQRLTSSQQIVSQLPEIEFKDKLNALFPPSGTT
YTQTDWQKIACALAARSAFSIITGGPGTGKTTTVVRLLALLQSIALIQHPECLLKICLAA
PTGKAAARLKESITGAIDKLPAFIQDDTTLKTSIPSNVTTLHRLLGSRPDSRLFRHDARH
PLPLDVLVIDEGSMIDLEMMAAVLLALPPHARLVILGDKDQLASVEAGSVLGALCHRAQQ
GHFQPETAQWVETATGEKIDPVLLDTNGLPLDQHIVMLRTNWRFDAASGIGQLARAVNTA
DSETIRTIWMQGYDDLFRHNLPDLEDSRLATILLGQSGEKDTPQGIAGYLGIIKAERPPL
DAEKVAFDAWAHQVLQSHGRFQLLCALRNGPFGVSGMNQHIEALLARHQLIKPGSIWYEG
RPVLVTRNDYALGLMNGDIGIALSYPTPNRTTGKLEWGIRVAFARGNGSGGIHWVLPSRL
LSIETVFALTVHKSQGSEFEHCALLLPPELNPVLTRELIYTGITRGKRWLSIICTGNSNI
IDQAVSRTVQRSGGLFAGSS
NT seq 2043 nt NT seq  +upstreamnt  +downstreamnt
atgagcactccagcaacaaacccgcaggaaatactggctctgctggaaagctgggttacc
cgtggctggctgcgcgagctggatcttgccttggtacgttttttaaaaactgaagttcct
gctatggatccggtattgatgctggcaaccgctctggtcagtcaccaactggggcgaggt
catgtttgtctggatctggacaatctcttaagcgatccttgtacggcgttgtcgttgccc
tctggccagaatgagccctctgccagaaaagaaattcagcatatcagcgttcttctggcg
gactggaaagcatccggctggcttacgcaacaaacggaactgatcagcaaggatgagaga
aatacaccgctggtgcttgctggccctcgtctgtatctgcgccgctactggcgttatgaa
cgtcaggtggaagctgctatctaccagcggctgaccagtagtcagcagattgtcagccag
ttgcctgaaattgagttcaaagacaaactgaatgcactttttccacccagcggtaccacg
tatacacaaacagactggcaaaaaatcgcttgtgcacttgctgcccgcagtgcattcagt
atcatcaccggcgggccaggaaccggaaaaacgaccactgtagttcgtctgctggcactg
ctgcaatcgattgcgctcatccagcatccggaatgcctccttaaaatctgcctggccgcc
cctactggcaaggcagcagcacgcctcaaggaatccattaccggcgccatcgacaagctg
cccgcttttattcaggacgataccacgctgaaaacgagcatcccaagcaacgtgacaacc
ctgcaccgtttgctgggctcgcgtccggattcccggctgttccggcatgatgcacgccac
ccgttgccactggatgtactggtgattgatgagggctccatgattgatctggaaatgatg
gcagccgtactccttgccttgccccctcacgctcgcctggttatcctgggagacaaggat
caactggcttctgttgaagcaggttctgtgctgggtgccttgtgccaccgggctcagcaa
gggcatttccagcctgaaactgcccaatgggttgaaacggccaccggagaaaagattgat
cccgttctgctggatacaaacggcttgccacttgaccagcatattgtgatgttgcggaca
aactggcgatttgatgctgccagcggcatcgggcaactggcccgtgcagtcaatactgct
gattcggaaaccattcgcacaatctggatgcaaggctatgatgacttgttccgtcataat
ttacctgatctcgaagatagccgcctggcaaccatcctgctcggccaatctggagaaaaa
gatacaccgcaaggaattgcgggttatctgggcatcattaaagcagagcggccaccactg
gatgcagaaaaagttgcatttgatgcctgggcgcatcaggtgttgcaatcgcacggccgt
tttcagttgctgtgtgcgctcagaaatggcccatttggggtcagcggcatgaatcagcat
attgaagcactgctggccagacaccagttgattaaacctggcagcatctggtatgaaggg
cgcccggtactggtcacccgcaatgattatgcgcttggtttgatgaacggggacatcggg
atagcgctcagctatcccacgcctaacaggacaaccggaaaactggaatggggtatacgg
gttgcctttgccagaggaaatggcagcggtggtattcactgggtgctgcccagtcgtctc
ttgtcaatcgaaactgtttttgcactgactgttcacaaatcacaaggctcggaatttgag
cattgtgccctgctgctaccacccgaactgaatcccgttctgacacgagagttgatctat
accggcatcacccggggaaaacgctggttatccatcatttgtaccggaaacagcaatatt
attgatcaagccgtttccagaacggtccagcgctccggcggattgtttgccggatcatcc
tga

DBGET integrated database retrieval system