KEGG   Nitrosomonas eutropha: Neut_1437Help
Entry
Neut_1437         CDS       T00393                                 

Definition
agmatinase (EC:3.5.3.11)
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
net  Nitrosomonas eutropha
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Neut_1437
Enzymes [BR:net01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Neut_1437
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1517861..1518829)
Genome map
AA seq 322 aa AA seqDB search
MSNGPVKIDGAIVRKTPYGMLREPTFSGILSFMRCSFRKDLTGAELVISDIPLDLAVSYR
SGARFGPLGIRQASAEVASLKPYPWGFDPFENLAVIDFGDCFLDVHNPMSIHEAIIDHAR
HILASGARMLTFGGDHSISYPLLKAHVEKTGTPLSLIHFDAHCDTWPDNSPASLNHGSMF
YKAVQDGLIDIKHSVQIGIRTWNDDFMGINILDADRVHREGTDAVVAEIERIVGNQPAYF
TFDIDCLDPAYAPGTGTPVCGGLSTAQALSIIRRLTAINLIGMDIVEVSPPYDHSQITAL
AAAHIACDLICLLAKRKADGLL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaacggccctgtcaaaattgatggagcaatagtacgcaaaacaccttatggcatg
ctgcgtgaaccgaccttctcgggcatactttcttttatgcgttgcagttttcggaaagac
ttgacaggtgccgagctggtgatcagcgatattccactggatttggcggtatcttaccgt
tctggcgcccggttcggaccactgggaattcgccaggcttccgctgaagtggcttcgctc
aaaccttatccatggggatttgatccattcgaaaatcttgctgtgatcgattttggagac
tgctttcttgatgtacataatccaatgtcgattcatgaggcgattatcgatcatgcccga
catattctggcatctggtgcgcgcatgttgacgttcggtggtgatcactctatttcttat
ccgttgttgaaagcacatgtagagaaaactggcactccactgtctttaatccattttgat
gcgcattgtgatacctggccagataattctccagcttcactgaatcatggttccatgttt
tacaaagcagtgcaggatggtttgattgatatcaagcattcggtacagattggtattcgt
acctggaatgatgatttcatggggattaatattctggatgctgatcgagtacatcgggag
gggacagatgcagtggttgcagaaattgaacgtatcgtcggtaatcagccagcctatttt
acgtttgatatcgattgccttgatcctgcttatgcgccgggcacaggcacaccggtttgt
ggggggttatcaaccgcacaggcgttatcaatcattcgcaggcttactgcaatcaacctg
attggaatggatatcgtagaagtatctccgccctatgatcacagtcagataaccgcactg
gctgcagcacatattgcttgcgacttgatttgtctgctggcaaaacgcaaagctgacggg
ctgttgtaa

DBGET integrated database retrieval system