KEGG   Nitrosomonas eutropha: Neut_1609Help
Entry
Neut_1609         CDS       T00393                                 

Definition
(GenBank) catalytic domain of components of various dehydrogenase complexes
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
net  Nitrosomonas eutropha
Pathway
net00010  Glycolysis / Gluconeogenesis
net00020  Citrate cycle (TCA cycle)
net00620  Pyruvate metabolism
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
net01130  Biosynthesis of antibiotics
net01200  Carbon metabolism
Module
net_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Neut_1609
   00020 Citrate cycle (TCA cycle)
    Neut_1609
   00620 Pyruvate metabolism
    Neut_1609
Enzymes [BR:net01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Neut_1609
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding CAT GCV_H HlyD_D23
Motif
Other DBs
NCBI-ProteinID: ABI59852
JGI: Neut1609
UniProt: Q0AFN0
Position
1692325..1693674
Genome map
AA seq 449 aa AA seqDB search
MAEVKKILVPDIGSFEDVPVIEIVVKPGDSVQAEDPLIVLESDKATVEVPSPYSGIIREI
MLQPGTKVSKDSEILTMEVVSNAEEKVSKPQPSGSPSEPQPARTEAAAEPNQPETIPVVK
STPTTAAKPATPPSSLPKLDQEVGAHGKTMPHASPSIRRFARELGVDLTRVVGTGPKLRI
LKEDVLAFVKQVLASEHNTGSVLNLLPWPYVDFAKFGPIELKSLSRIRQISGANLHRNWV
MIPHVTQFDEADITDLEALRKTHNETRQNNGTKLTILAFLIKAVTAALKKFPEFNASLDN
STEESQLIIKYYYHLGFAVDTPNGLVVPVIRDADQKGVIDIAQELARLSSLARKGKLMPS
DMQGASFTISSLGGIGGTGFTPIINAPEVAILGISRAGLKPVYQNEKFVPRLILPFSISY
DHRVIDGAAAARFTTHLASILTDMRLALF
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtggctgaagtcaagaaaattctggtcccggatatcgggagttttgaagatgtcccggtt
atcgaaatcgtggtcaagcctggcgatagcgtacaggctgaagatcctttaatcgtgttg
gaatcagacaaggccacggttgaggtgccctcgccttactccggaataatccgagaaatt
atgcttcagccaggcactaaggtctctaaggattcagaaatcctgactatggaagtggta
tcaaatgctgaagaaaaggtctccaaacctcagccatccgggtctccatccgaaccacaa
cccgcacgaacagaagcagcagccgaaccaaatcagcctgaaactataccggtggtcaaa
tctacacccaccacagcagcgaaaccagcgacccctccttcttcattgccgaaacttgat
caggaagtcggagcgcatggtaagacaatgcctcatgcaagtccctcgataagacgattt
gcccgggaattgggagtggatctgaccagagtagttggaaccggccccaagctgcgtatt
ctcaaggaagatgtactggctttcgtaaaacaggtattagctagcgaacacaatactgga
agtgtgcttaacctactgccctggccatatgtagattttgcgaaatttgggccaatcgaa
ctgaaatcattgtcacgtatccgacaaatttcaggtgctaaccttcatcgcaattgggtc
atgattccgcatgtcacgcagttcgacgaggcagatatcaccgatctggaagcgctcaga
aaaactcataatgaaacccggcagaataacggcaccaaactaactatattagcttttctt
atcaaggcggttacagcagctctgaaaaaattcccagaatttaacgcttccctggacaac
agtacagaggaaagtcaactcatcataaaatattactaccatttgggatttgcagtcgat
acacccaacgggctggtggttccagttattcgggatgccgatcagaaaggagtaatcgat
atcgctcaggaacttgccaggctatcctcacttgcccgtaaaggtaaattaatgcccagt
gacatgcaaggtgcaagctttactatatcgagcctgggaggtatcggtggaaccggcttt
acacccattatcaatgcgccggaagtagccattctagggatatcccgtgcaggtctgaaa
ccagtttatcagaatgaaaaatttgttccacgcctgatactcccgttctcgatatcctat
gatcaccgggtaattgatggtgcagcggccgcacgtttcactacacatttggccagcatt
ctgacagacatgcgacttgcgctgttctga

DBGET integrated database retrieval system