KEGG   Nitrosomonas eutropha: Neut_1705Help
Entry
Neut_1705         CDS       T00393                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
net  Nitrosomonas eutropha
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:net01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1803955..1804566
Genome map
AA seq 203 aa AA seqDB search
MVLGDSLSAGYGLPPQSGWVNLLERRLQSQSAGYKVINASISGEITLGGRKRIEQALKNN
KPDIVIVALGANDGLQGRSISSIYENLEAIILTCKQYNATPLLISMQLPPNYGISYTQKF
RDIYPRLAKNQQLQLAPFLMEGFGDQTGFFQADGIHPTAQAQEKMLDNIWPALVSVLKSQ
QTQTSTASKNLIDGTDTTTGLLH
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgggggacagcctgtccgcaggatatgggctgccaccgcaatccggatgggta
aatctgctggaacggcgattacaaagccaatccgctggttacaaggtgataaacgccagt
atcagcggggaaatcaccttaggcgggcgcaaacggatagaacaggcacttaaaaacaat
aaaccggatatcgtcatcgttgcactgggagcaaatgacggtttgcaaggccgttcaatc
tcatccatttacgagaatctggaagcgattatcctgacctgcaaacagtacaacgccacc
ccactcttgatcagcatgcaattaccgcccaattatggcataagttatacgcaaaagttt
cgtgatatctacccgcgcctggcaaagaatcagcaattacaactggctccattcctgatg
gaaggttttggcgatcaaaccggattttttcaggcggacggcatacaccccactgcccag
gcgcaggaaaaaatgcttgataatatctggcctgcactggtttccgtgttgaagtcacaa
caaacacagacatccactgccagcaaaaatctgattgatggaactgatacaacaaccgga
ttgctgcactaa

DBGET integrated database retrieval system