KEGG   Nitrosomonas eutropha: Neut_1705Help
Entry
Neut_1705         CDS       T00393                                 

Definition
G-D-S-L family lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
net  Nitrosomonas eutropha
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Neut_1705
Enzymes [BR:net01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Neut_1705
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Neut_1705
Lipid biosynthesis proteins [BR:net01004]
 Fatty acid synthase
  Component type
   Neut_1705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1803955..1804566
Genome map
AA seq 203 aa AA seqDB search
MVLGDSLSAGYGLPPQSGWVNLLERRLQSQSAGYKVINASISGEITLGGRKRIEQALKNN
KPDIVIVALGANDGLQGRSISSIYENLEAIILTCKQYNATPLLISMQLPPNYGISYTQKF
RDIYPRLAKNQQLQLAPFLMEGFGDQTGFFQADGIHPTAQAQEKMLDNIWPALVSVLKSQ
QTQTSTASKNLIDGTDTTTGLLH
NT seq 612 nt NT seq  +upstreamnt  +downstreamnt
atggtgctgggggacagcctgtccgcaggatatgggctgccaccgcaatccggatgggta
aatctgctggaacggcgattacaaagccaatccgctggttacaaggtgataaacgccagt
atcagcggggaaatcaccttaggcgggcgcaaacggatagaacaggcacttaaaaacaat
aaaccggatatcgtcatcgttgcactgggagcaaatgacggtttgcaaggccgttcaatc
tcatccatttacgagaatctggaagcgattatcctgacctgcaaacagtacaacgccacc
ccactcttgatcagcatgcaattaccgcccaattatggcataagttatacgcaaaagttt
cgtgatatctacccgcgcctggcaaagaatcagcaattacaactggctccattcctgatg
gaaggttttggcgatcaaaccggattttttcaggcggacggcatacaccccactgcccag
gcgcaggaaaaaatgcttgataatatctggcctgcactggtttccgtgttgaagtcacaa
caaacacagacatccactgccagcaaaaatctgattgatggaactgatacaacaaccgga
ttgctgcactaa

DBGET integrated database retrieval system