KEGG   Nitrosomonas eutropha: Neut_2007Help
Entry
Neut_2007         CDS       T00393                                 

Definition
(GenBank) phosphomannomutase
  KO
K15778  phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
net  Nitrosomonas eutropha
Pathway
net00010  Glycolysis / Gluconeogenesis
net00030  Pentose phosphate pathway
net00051  Fructose and mannose metabolism
net00052  Galactose metabolism
net00230  Purine metabolism
net00500  Starch and sucrose metabolism
net00520  Amino sugar and nucleotide sugar metabolism
net00521  Streptomycin biosynthesis
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
net01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Neut_2007
   00030 Pentose phosphate pathway
    Neut_2007
   00051 Fructose and mannose metabolism
    Neut_2007
   00052 Galactose metabolism
    Neut_2007
   00500 Starch and sucrose metabolism
    Neut_2007
   00520 Amino sugar and nucleotide sugar metabolism
    Neut_2007
  Nucleotide metabolism
   00230 Purine metabolism
    Neut_2007
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Neut_2007
Enzymes [BR:net01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Neut_2007
    5.4.2.8  phosphomannomutase
     Neut_2007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PGM_PMM_I PGM_PMM_II PGM_PMM_III PGM_PMM_IV
Motif
Other DBs
NCBI-ProteinID: ABI60230
JGI: Neut2007
UniProt: Q0AEK2
Position
2120536..2121915
Genome map
AA seq 459 aa AA seqDB search
MNTLPRREIFKAYDIRGIVETALTPEVVEQIGHAIGSEARARQLTAIAVGRDGRLSGPQL
VQALTNGIRKSGIDVIDIGMVATPVLYYAAHELCHYSGVMVTGSHNPPEYNGLKIVLGGE
TLAAETIQSLRLRIEQNNLTHGQGGYRQHDIIPAYLQRIVEDVKLARPIKIVVDCGNGVT
GILAPELYRRLGCEVIELFCEVDGTFPNHHPDPSVPENLQDVIRTLATTDAEIGFAFDGD
GDRLGVVTKDGSIIFPDRQLMLFAADVLSRNPGGQIIYDVKCTRTLAPWITQHGGKPIMW
KTGHSFIKAKLKETGALLAGEMSGHIFFQERWYGFDDGLYAGARLLELLSKQTDPEAVLH
ALPDTINTPELQIRLKEGENHALIAQLQQEANFPEADQVITIDGLRVEYKDGFGLIRASN
TTPVAVLRFEADNQDALKRIQQDFRQIILQARPDANLPF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacttccacgccgcgaaatcttcaaggcttacgacatacgtggcatcgtagaa
accgcactgactccggaagtagtggaacaaatcggccatgccattggttccgaagcacgc
gcacgtcagctgacagctattgcagtgggtcgcgatggccgtttatccggtcctcaactg
gtgcaagccttgacgaacggtatccgtaaaagtggaattgatgtcatcgatattggcatg
gtcgccaccccggtgctgtattacgctgctcacgaactctgtcattattctggggtaatg
gtaaccggcagccacaatccgccagaatataacggtctcaagatcgtgctgggaggcgaa
acgctggcagccgagaccattcaatcattacggttgcgtattgagcaaaataacctgacg
catggacaaggcggttatcgccaacacgacatcatccccgcctatttgcaacgcatcgtg
gaggatgtcaagctggctcggccaatcaaaatcgtggtggactgcggcaatggcgtaact
ggcattctggcgccagaactgtatcgccgcctgggctgcgaagtaatcgagctgttttgt
gaagtggatggtactttcccgaatcatcatcccgatccttcagtcccggagaatttgcag
gatgtcatccgcacacttgctactaccgatgctgaaattggttttgcctttgatggcgat
ggtgaccggctgggcgtcgtcaccaaggatggaagcatcattttcccggatcgccaactt
atgctgtttgctgccgatgtgttgtccagaaaccctggcggccagatcatctacgatgtc
aaatgcacacgcacactggcaccgtggatcacacaacatggcggcaaacccatcatgtgg
aaaacggggcactccttcattaaggccaagttaaaggaaacaggcgcactcctggcaggc
gagatgagcggccatatctttttccaggaacgttggtacggattcgacgatggcctatac
gcaggtgcgcgtctgctggaattattgagtaaacaaaccgatccggaagcggtgctgcat
gccctgcctgatacgatcaacacacctgaattgcagatcagactcaaggaaggagaaaat
cacgccttgattgcgcaacttcagcaggaggcaaacttccctgaggcggatcaggtgatt
acgattgacgggctgcgggtggaatacaaggatggattcggcctgatccgggcatccaat
accactccggtcgcagtactacgtttcgaggctgacaatcaggatgcgctgaaacgtatc
cagcaagattttcgccaaatcattctgcaagccaggccggatgcaaatctgcctttctaa

DBGET integrated database retrieval system