KEGG   Nitrosomonas eutropha: Neut_2007Help
Entry
Neut_2007         CDS       T00393                                 

Definition
phosphomannomutase (EC:5.4.2.8)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
net  Nitrosomonas eutropha
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Neut_2007
   00030 Pentose phosphate pathway
    Neut_2007
   00051 Fructose and mannose metabolism
    Neut_2007
   00052 Galactose metabolism
    Neut_2007
   00500 Starch and sucrose metabolism
    Neut_2007
   00520 Amino sugar and nucleotide sugar metabolism
    Neut_2007
  Nucleotide metabolism
   00230 Purine metabolism
    Neut_2007
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Neut_2007
Enzymes [BR:net01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     Neut_2007
    5.4.2.8  phosphomannomutase
     Neut_2007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2120536..2121915
Genome map
AA seq 459 aa AA seqDB search
MNTLPRREIFKAYDIRGIVETALTPEVVEQIGHAIGSEARARQLTAIAVGRDGRLSGPQL
VQALTNGIRKSGIDVIDIGMVATPVLYYAAHELCHYSGVMVTGSHNPPEYNGLKIVLGGE
TLAAETIQSLRLRIEQNNLTHGQGGYRQHDIIPAYLQRIVEDVKLARPIKIVVDCGNGVT
GILAPELYRRLGCEVIELFCEVDGTFPNHHPDPSVPENLQDVIRTLATTDAEIGFAFDGD
GDRLGVVTKDGSIIFPDRQLMLFAADVLSRNPGGQIIYDVKCTRTLAPWITQHGGKPIMW
KTGHSFIKAKLKETGALLAGEMSGHIFFQERWYGFDDGLYAGARLLELLSKQTDPEAVLH
ALPDTINTPELQIRLKEGENHALIAQLQQEANFPEADQVITIDGLRVEYKDGFGLIRASN
TTPVAVLRFEADNQDALKRIQQDFRQIILQARPDANLPF
NT seq 1380 nt NT seq  +upstreamnt  +downstreamnt
atgaatacacttccacgccgcgaaatcttcaaggcttacgacatacgtggcatcgtagaa
accgcactgactccggaagtagtggaacaaatcggccatgccattggttccgaagcacgc
gcacgtcagctgacagctattgcagtgggtcgcgatggccgtttatccggtcctcaactg
gtgcaagccttgacgaacggtatccgtaaaagtggaattgatgtcatcgatattggcatg
gtcgccaccccggtgctgtattacgctgctcacgaactctgtcattattctggggtaatg
gtaaccggcagccacaatccgccagaatataacggtctcaagatcgtgctgggaggcgaa
acgctggcagccgagaccattcaatcattacggttgcgtattgagcaaaataacctgacg
catggacaaggcggttatcgccaacacgacatcatccccgcctatttgcaacgcatcgtg
gaggatgtcaagctggctcggccaatcaaaatcgtggtggactgcggcaatggcgtaact
ggcattctggcgccagaactgtatcgccgcctgggctgcgaagtaatcgagctgttttgt
gaagtggatggtactttcccgaatcatcatcccgatccttcagtcccggagaatttgcag
gatgtcatccgcacacttgctactaccgatgctgaaattggttttgcctttgatggcgat
ggtgaccggctgggcgtcgtcaccaaggatggaagcatcattttcccggatcgccaactt
atgctgtttgctgccgatgtgttgtccagaaaccctggcggccagatcatctacgatgtc
aaatgcacacgcacactggcaccgtggatcacacaacatggcggcaaacccatcatgtgg
aaaacggggcactccttcattaaggccaagttaaaggaaacaggcgcactcctggcaggc
gagatgagcggccatatctttttccaggaacgttggtacggattcgacgatggcctatac
gcaggtgcgcgtctgctggaattattgagtaaacaaaccgatccggaagcggtgctgcat
gccctgcctgatacgatcaacacacctgaattgcagatcagactcaaggaaggagaaaat
cacgccttgattgcgcaacttcagcaggaggcaaacttccctgaggcggatcaggtgatt
acgattgacgggctgcgggtggaatacaaggatggattcggcctgatccgggcatccaat
accactccggtcgcagtactacgtttcgaggctgacaatcaggatgcgctgaaacgtatc
cagcaagattttcgccaaatcattctgcaagccaggccggatgcaaatctgcctttctaa

DBGET integrated database retrieval system