KEGG   Nitrosomonas eutropha: Neut_2187Help
Entry
Neut_2187         CDS       T00393                                 

Definition
agmatinase
Orthology
K01480  
agmatinase [EC:3.5.3.11]
Organism
net  Nitrosomonas eutropha
Pathway
Arginine and proline metabolism
Metabolic pathways
Module
Polyamine biosynthesis, arginine => agmatine => putrescine => spermidine
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Neut_2187
Enzymes [BR:net01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     Neut_2187
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2319470..2320414
Genome map
AA seq 314 aa AA seqDB search
MNTWDNGFRGKPGQGMSHTLSFGGAASFFRVPYQADITGVDVVVTGVPLDIATTNRSGAR
LGPRAIRNASLSLAWERPWPWNIDPMTALRVIDCGDCEPVTDDLLSVAHIEAHIANIIGA
GAAALVLGGDHFVAYPSLRAHAAVHGPISLIHFDAHTDTWPSSGNGINHGTMFYQATHEG
IVNPASSTQIGIRTTNDDTLGFHIVSAADVHQTTGRDIASQIHERVGEKPVYITFDIDCL
DPAFAPGTGTPVPGGLSSFQALSIIRELKGINLIGMDVVEVAPAYDHAEITALAAAQIAV
ELLCLYAESHRQRN
NT seq 945 nt NT seq  +upstreamnt  +downstreamnt
atgaatacttgggataacgggtttcgtggcaaacccggacaggggatgtcgcatactctg
agtttcgggggtgcagccagtttttttcgcgtgccttaccaggcagatatcacaggagtt
gatgtggtcgtaaccggagtgccgttggatatcgccaccaccaatcgatccggcgcgcga
ctggggcctcgcgccattcgaaatgcatcgttatcgctggcatgggagcgtccatggcct
tggaatatagacccgatgactgcattgcgtgtaattgattgtggtgattgcgaacccgtt
actgacgatttgttgagcgtagcgcatatcgaggcacatatcgccaatattatcggggca
ggagcagcagccttggtgctcggtggagatcattttgtcgcttacccaagcctgcgggca
cacgccgctgtgcatggtcctatcagcctgattcattttgatgcccatactgatacttgg
ccttcctccggtaatggtattaatcacggcactatgttttatcaggcaacacatgaggga
attgtaaatccagcatcatccacacaaattggcattcgcaccactaatgatgacacactg
ggttttcatatcgtttccgcagcagatgtgcatcaaacgaccggtcgcgacatagccagc
cagatacacgagcgagttggtgaaaaaccggtgtatatcacctttgatatcgattgcttg
gacccagcttttgcacccggcactggcacacctgtaccgggtggactgtcatccttccag
gcactgagtattattcgtgaactaaaaggcatcaatctgataggcatggatgtcgtcgaa
gtggcgcccgcgtatgatcatgctgaaattactgcgctagcggctgcacagattgcagtt
gaattgttatgtctttacgctgaaagtcacagacaaagaaattga

DBGET integrated database retrieval system