KEGG   Nitrosomonas eutropha: Neut_2244Help
Entry
Neut_2244         CDS       T00393                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
net  Nitrosomonas eutropha
Pathway
net00521  Streptomycin biosynthesis
net00523  Polyketide sugar unit biosynthesis
net01130  Biosynthesis of antibiotics
Module
net_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Neut_2244
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Neut_2244
Enzymes [BR:net01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Neut_2244
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom Peptidase_M1
Motif
Other DBs
NCBI-ProteinID: ABI60461
JGI: Neut2244
UniProt: Q0ADX1
Position
2369448..2369993
Genome map
AA seq 181 aa AA seqDB search
MKATPLAIPDIYLIEPKVYGDERGFFFESFNQASFEEIIGRPVQFVQDNHSRSMKNVLRG
LHYQIQQPQGKLVRVVQGEVFDVAIDLRKSSATFGQWTGEILSAENKYQLWIPEGFAHGF
VVLSNTAEFLYKTTDYYAPVHERCILWNDPTLDIAWPAGIQPALSTKDALGTPFDQAEVF
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgaaagccacacctcttgcgattcctgatatctatctaatcgaacccaaagtatacggc
gatgaacgcggcttcttttttgaaagcttcaatcaagccagttttgaagaaatcatcggc
aggccggttcagttcgtgcaggataatcacagccgcagtatgaagaatgtcctgcgcggc
ctgcattatcagattcagcaaccgcagggcaagctggtgcgtgtggtgcaaggtgaagtg
ttcgacgtagcgattgatctgcgcaaaagctcagcaacctttggccaatggacgggggaa
atcctttctgcagaaaacaaataccaactctggatacctgaaggatttgcccatggtttt
gtcgtactgagcaataccgccgaatttctctacaaaaccacggattactatgcacctgtc
catgagcgctgcattctctggaatgacccaacactcgacattgcctggccagcaggtatt
cagcctgctctatccaccaaggatgccctgggaaccccatttgatcaggccgaggtcttt
gactaa

DBGET integrated database retrieval system