KEGG   Nitrosomonas eutropha: Neut_2323Help
Entry
Neut_2323         CDS       T00393                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
net  Nitrosomonas eutropha
Brite
Enzymes [BR:net01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Neut_2323
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT RrnaAD Methyltransf_25 Methyltransf_31 NodS Methyltransf_11 Methyltransf_23 Methyltransf_4
Motif
Other DBs
NCBI-ProteinID: ABI60540
JGI: Neut2323
UniProt: Q0ADP2
Position
complement(2448466..2449134)
Genome map
AA seq 222 aa AA seqDB search
MSVRHSGIGMTSPRTRVRMVERLREQGVRDEVVLAAMGSIPRHLFVEEALASRAYEDVAL
PINYGQTISSPWIVGRMSELLRNGGNNSLRKVLEIGTGCGYQTAVLAKIANEVYSIERIG
PLLTRTRIRLRELGIRNIYLKHADGMRGLLEAGPFDGIMMTAVIPEIPETLLEQLAMGGR
MVFPKGNRQQYLCVIDHTTEGFVETILDEVMFVPILPGTINR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtacgccattctggtattggcatgacttcgccgcgaacgagggttcgcatggtc
gagcgtttaagggagcaaggtgttagagatgaggtggtattggctgcaatgggttctatt
ccacgccatcttttcgttgaagaagcattggcatcccgggcatatgaagatgtggcattg
ccaattaattacggacaaacaatctccagcccctggattgtaggccgtatgagtgaattg
ctgcggaatggtgggaacaattcgctgagaaaagtactggaaatcggaacagggtgcggc
tatcagactgctgttttggccaagatagcgaatgaagtctattcaattgagcggataggt
cccttgttgacacgtactcgcattcgattgcgtgaattgggtattcgtaatatttacctg
aaacatgctgatggaatgcgtggattgttggaggcgggtccattcgatggaataatgatg
actgcagttattccagagataccagagacgctcttggaacaattggcaatgggtggcagg
atggtattcccgaaaggaaacaggcagcagtatctttgtgtaattgatcatactaccgag
ggttttgttgaaacgatcttggatgaggtaatgtttgtgcccattcttcccgggacaatc
aacaggtag

DBGET integrated database retrieval system