KEGG   Nitrosomonas eutropha: Neut_2456Help
Entry
Neut_2456         CDS       T00393                                 

Definition
(GenBank) Aldose 1-epimerase
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
net  Nitrosomonas eutropha
Pathway
net00010  Glycolysis / Gluconeogenesis
net01100  Metabolic pathways
net01110  Biosynthesis of secondary metabolites
net01120  Microbial metabolism in diverse environments
net01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Neut_2456
Enzymes [BR:net01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Neut_2456
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim CHASE5
Motif
Other DBs
NCBI-ProteinID: ABI60664
JGI: Neut2456
UniProt: Q0ADB8
Position
complement(2570220..2571125)
Genome map
AA seq 301 aa AA seqDB search
MNIEQLNQKYGIGEQVVFKEGEGGLPFIHIKNEKANALISIYGGQVLAFRPIHAQDDLLF
LSKRAYYQQGKAIKGGVPICWPWFGPDPEGKGRSAHGFMRNRMWDVIETSTTPENGTRIV
LGSTDTEETRSIWPRAFILRLEITISDTLNLELITRNPGSQVCTITQAFHTYFNVGDIRQ
THVSSLENTRYIDKVHDNLEKNQIGAVTIEAEVDRIYQSVDSNLIIHDTARKRRIRITSK
GNRTAVVWNPWAKISTEMADLEDDDYLRFICVETTNAATDRVHIQPGSEFRLVANYRIEQ
D
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaatatcgagcaactaaatcaaaaatacggaattggggagcaggtagtttttaaagag
ggagaagggggtttaccctttattcatatcaagaatgaaaaggccaatgcactgatctcg
atttacggcggacaggtgcttgcattccggccgatacatgcgcaagacgatcttctgttt
ttaagcaagcgcgcctattatcaacagggcaaggcaatcaaaggcggtgtgccgatttgc
tggccatggtttggcccggatccggaaggtaaagggcgatcagcacatggttttatgcgc
aatcgcatgtgggatgtcatcgaaacatccacaaccccggaaaacggcactcgaatcgta
ctgggatcaaccgataccgaagaaacacgatccatctggccacgcgcattcattttgaga
ctggaaattaccattagcgatacgctcaatctggagctgatcactcgcaatccgggctca
caagtatgtacgatcacacaggcttttcatacctacttcaacgtgggggatattcggcag
acacatgtatccagcctggaaaacactcgctatattgataaagtgcacgataacctggaa
aaaaaccagatcggtgctgtcaccattgaggcggaagtggaccgaatttaccagtcagtc
gatagcaatctcatcattcacgatacagctcgcaaacgccgtatccgcatcacttctaaa
gggaacagaaccgccgttgtgtggaatccctgggcaaagatctcgacagaaatggcagat
ctggaagatgatgattacctgcgttttatttgtgtggaaaccaccaatgccgcgacagac
cgggttcatatccagcccggcagtgagttccggttggttgccaattaccggattgagcag
gactga

DBGET integrated database retrieval system