KEGG   Nitrosomonas eutropha: Neut_2485Help
Entry
Neut_2485         CDS       T00393                                 

Definition
succinate dehydrogenase, cytochrome b subunit
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
net  Nitrosomonas eutropha
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:net00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Neut_2485
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Neut_2485
   00650 Butanoate metabolism
    Neut_2485
  Energy metabolism
   00190 Oxidative phosphorylation
    Neut_2485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2613244..2613597
Genome map
AA seq 117 aa AA seqDB search
MVKPVNRIITGAHYGLRDWLVQRVTAVIMAVYTGLLIVLVVVYQPEGYEEFKSLFSIQWV
KIASLLCFAGLCWHAWVGVRNVLMDYVHPMFIRLTLQVMCIVALLGYLIWFLDILWG
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaacctgtaaaccgtattataaccggggcacattatggtttaagggactggctt
gtgcagcgagtgaccgctgtaataatggcggtctataccggattactgattgtacttgtg
gttgtttaccaacctgaaggttacgaagaatttaaatcgctattttccattcagtgggta
aaaattgcttcattgctttgttttgccggtctatgctggcatgcttgggtgggcgtgcgc
aatgtcctgatggattatgttcacccgatgtttattcgtctgacactgcaagtcatgtgt
atcgtggcattattgggctatctgatatggttcttggatattttgtggggctga

DBGET integrated database retrieval system