KEGG   Nitrosomonas europaea: NE0037Help
Entry
NE0037            CDS       T00130                                 

Gene name
pcm
Definition
pcm; protein-L-isoaspartate o-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
neu  Nitrosomonas europaea
Brite
Enzymes [BR:neu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NE0037 (pcm)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(49394..50050)
Genome map
AA seq 218 aa AA seqDB search
MVNLEQTRFNMVEQQIRTWNVLNQDILDLLYQVKREEFVPAAYRFMAFVDMEIPLEHGAV
MLTPKMEARILQELHIRKTDKILEVGTGTGYMTALLSKLGTHVFSVEIVPELHTMAHINL
QTHDITNVTLELGDAARGWPGHGPYDVIVLTASTPVLPEAFQQNLAPGGRLFAIIGEEPV
MEATLITCTSPGNYSSTCLFETCTAPFRNALQRESFHF
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggtgaacctcgaacaaacccgcttcaacatggtagaacaacagatcagaacctggaat
gtactgaatcaggacattctcgatttgctgtatcaggtcaaacgtgaagaattcgtacct
gccgcttatcgtttcatggcattcgtggatatggagatcccgctggagcatggtgccgtt
atgttaacacccaaaatggaagcacggattctgcaggaactgcatatcagaaaaactgac
aaaatccttgaggttggcaccggaacaggctacatgactgcattgctgtccaaactcggg
actcatgtcttcagtgtggaaatcgtgcccgagcttcataccatggcgcacatcaatctg
cagacgcacgacattaccaatgtcacccttgaactgggagatgccgctcgtggatggccc
ggtcacggaccttatgacgtcatcgttctgactgcctccacccccgttttaccagaggca
tttcagcaaaatctggcaccgggaggtcgattgtttgccatcattggtgaagaacccgtc
atggaagcgacgctgataacctgtacctcgcccggtaattacagttcgacatgcctgttc
gagacttgtaccgcacccttcagaaatgcgcttcagcgtgagagctttcacttttga

DBGET integrated database retrieval system