KEGG   Nitrosomonas europaea: NE0050Help
Entry
NE0050            CDS       T00130                                 

Gene name
sucC
Definition
ATP-citrate lyase/succinyl-CoA ligase:ATP-grasp domain (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
neu  Nitrosomonas europaea
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    NE0050 (sucC)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NE0050 (sucC)
   00640 Propanoate metabolism
    NE0050 (sucC)
   00660 C5-Branched dibasic acid metabolism
    NE0050 (sucC)
Enzymes [BR:neu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NE0050 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
64417..65610
Genome map
AA seq 397 aa AA seqDB search
MKIHEYQAKAILSRYGVSVPAGVACFSVEEAVLAAEKLGGNKWVVKAQIYAGGRGKGGGV
KLAKSIAEVRQFAEAMLFAPLVTHQTGPQGRIVHRLYIEQGVDIRHEYYLALVVDRTSQC
VSLIASDAGGMDIEQVAAGSPEKIHKIQIDPLAGLNLRDAERIVREIDLPESCQSAAITM
LDALYRAFDENDASLLEINPLIVTPDNRLIALDAKMNFDDNALFRHPEIVALRDLDEDDP
LEAEASQHGLSYIPLDGDIACLVNGAGLAMATMDIIKLYGGNPANFLDVGGGATVEKVTE
AFKLMLRNPGLQAILVNIFGGIMRCDVIAEGVVSAAREVKLTVPLIVRLEGTNVELGKKI
LADSGLTIISAGNMADAARKAVDAAARHCAEAATGGV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgaataccaggctaaagcgattctcagccgttacggggtgagtgtgcca
gccggggttgcctgtttcagcgtggaggaagcggtattggctgccgagaagctgggtgga
aataaatgggtggtcaaagcacagatttacgctggcggacgcggtaagggcggcggagtg
aaactggcaaaatccattgcggaagtccggcagtttgctgaagctatgctgtttgctccg
ctggtaacgcaccagaccggcccgcaaggtcggatcgttcaccgactgtatatcgaacag
ggagtcgacatccgccatgagtattatctggcactggtggtagaccgtacttcacagtgt
gtgagtttgattgcaagtgatgccggggggatggatatcgaacaggttgcagccggctcg
ccggaaaaaatacacaaaattcagatcgatccgctggcgggattgaatcttcgggatgcc
gagagaatcgtgcgtgagatcgatttgcctgaatcgtgtcagtcggctgcgataactatg
ctggatgcgctgtatcgggcattcgatgaaaatgatgcttcgttgctcgaaatcaatccg
ctgattgtcacgccggataaccgcctgattgcgctggatgccaaaatgaatttcgatgac
aatgccctgtttcgtcatcctgaaatcgttgccttgcgggatctggatgaagatgatccg
ctcgaggcagaggcgtcgcagcatgggctttcttatattccactggatggtgatattgcc
tgcttggtcaacggagccggtctggcgatggccaccatggacatcattaaactctatggc
ggtaatccagctaattttctggatgtgggagggggagcaaccgtagagaaagtgaccgaa
gcattcaagctgatgctgagaaaccccggtttgcaggcaatactggtcaatatttttggc
gggattatgcgttgtgatgtgattgctgaaggggtggtatcggcagcacgtgaggtgaaa
ctgactgttccattgattgttcgactggaggggaccaacgtggagctgggaaaaaagatt
ctggcagattcgggattaacgatcatttctgccggcaacatggctgatgctgccagaaaa
gcggttgatgcagctgcccgacattgtgctgaagctgcaaccggaggagtgtga

DBGET integrated database retrieval system