KEGG   Nitrosomonas europaea: NE0050Help
Entry
NE0050            CDS       T00130                                 

Gene name
sucC
Definition
(GenBank) ATP-citrate lyase/succinyl-CoA ligases:ATP-grasp domain
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
neu  Nitrosomonas europaea
Pathway
neu00020  Citrate cycle (TCA cycle)
neu00640  Propanoate metabolism
neu00660  C5-Branched dibasic acid metabolism
neu01100  Metabolic pathways
neu01110  Biosynthesis of secondary metabolites
neu01120  Microbial metabolism in diverse environments
neu01130  Biosynthesis of antibiotics
neu01200  Carbon metabolism
Module
neu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
neu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    NE0050 (sucC)
   00640 Propanoate metabolism
    NE0050 (sucC)
   00660 C5-Branched dibasic acid metabolism
    NE0050 (sucC)
Enzymes [BR:neu01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     NE0050 (sucC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: CAD83961
JGI: NE0050
UniProt: Q82Y39
Position
64417..65610
Genome map
AA seq 397 aa AA seqDB search
MKIHEYQAKAILSRYGVSVPAGVACFSVEEAVLAAEKLGGNKWVVKAQIYAGGRGKGGGV
KLAKSIAEVRQFAEAMLFAPLVTHQTGPQGRIVHRLYIEQGVDIRHEYYLALVVDRTSQC
VSLIASDAGGMDIEQVAAGSPEKIHKIQIDPLAGLNLRDAERIVREIDLPESCQSAAITM
LDALYRAFDENDASLLEINPLIVTPDNRLIALDAKMNFDDNALFRHPEIVALRDLDEDDP
LEAEASQHGLSYIPLDGDIACLVNGAGLAMATMDIIKLYGGNPANFLDVGGGATVEKVTE
AFKLMLRNPGLQAILVNIFGGIMRCDVIAEGVVSAAREVKLTVPLIVRLEGTNVELGKKI
LADSGLTIISAGNMADAARKAVDAAARHCAEAATGGV
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattcatgaataccaggctaaagcgattctcagccgttacggggtgagtgtgcca
gccggggttgcctgtttcagcgtggaggaagcggtattggctgccgagaagctgggtgga
aataaatgggtggtcaaagcacagatttacgctggcggacgcggtaagggcggcggagtg
aaactggcaaaatccattgcggaagtccggcagtttgctgaagctatgctgtttgctccg
ctggtaacgcaccagaccggcccgcaaggtcggatcgttcaccgactgtatatcgaacag
ggagtcgacatccgccatgagtattatctggcactggtggtagaccgtacttcacagtgt
gtgagtttgattgcaagtgatgccggggggatggatatcgaacaggttgcagccggctcg
ccggaaaaaatacacaaaattcagatcgatccgctggcgggattgaatcttcgggatgcc
gagagaatcgtgcgtgagatcgatttgcctgaatcgtgtcagtcggctgcgataactatg
ctggatgcgctgtatcgggcattcgatgaaaatgatgcttcgttgctcgaaatcaatccg
ctgattgtcacgccggataaccgcctgattgcgctggatgccaaaatgaatttcgatgac
aatgccctgtttcgtcatcctgaaatcgttgccttgcgggatctggatgaagatgatccg
ctcgaggcagaggcgtcgcagcatgggctttcttatattccactggatggtgatattgcc
tgcttggtcaacggagccggtctggcgatggccaccatggacatcattaaactctatggc
ggtaatccagctaattttctggatgtgggagggggagcaaccgtagagaaagtgaccgaa
gcattcaagctgatgctgagaaaccccggtttgcaggcaatactggtcaatatttttggc
gggattatgcgttgtgatgtgattgctgaaggggtggtatcggcagcacgtgaggtgaaa
ctgactgttccattgattgttcgactggaggggaccaacgtggagctgggaaaaaagatt
ctggcagattcgggattaacgatcatttctgccggcaacatggctgatgctgccagaaaa
gcggttgatgcagctgcccgacattgtgctgaagctgcaaccggaggagtgtga

DBGET integrated database retrieval system