KEGG   Nitrosomonas europaea: NE0108Help
Entry
NE0108            CDS       T00130                                 

Gene name
dapE
Definition
(GenBank) Peptidase family M20/M25/M40
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
neu  Nitrosomonas europaea
Pathway
neu00300  Lysine biosynthesis
neu01100  Metabolic pathways
neu01120  Microbial metabolism in diverse environments
neu01230  Biosynthesis of amino acids
Module
neu_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    NE0108 (dapE)
Enzymes [BR:neu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     NE0108 (dapE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer
Motif
Other DBs
NCBI-ProteinID: CAD84019
JGI: NE0108
UniProt: Q82XY4
Position
137822..138952
Genome map
AA seq 376 aa AA seqDB search
MSNSTLTLAQMLIARRSLTPDDDGCQKMIMHRLAGLGFKSDSMTFGEVENLWTRKGSDAP
LVCFAGHTDVVPTGPVTQWDSDPFTPVVRDGFLYGRGAADMKTSLAAFVTAIEEFIELHP
DHKGSIALLITSDEEGPAVDGTVKVVEALQTRGEMIDYCIVGEPTCTNQLGDTIKNGRRG
SLSGNLTVRGIQGHIAYPHLARNPIHTAAPAIAELAQTVWDNGNEYFPATTWHISNIHGG
TGATNVIPGEINLLFNFRFSTASTVDSLKARVHEILDRHGLDYELIWELSGKPYLTPRGT
LADAVSAAIREVTGIEPELSTTGGTSDGRFIADICQQVVEFGPRNATIHKINESVEVADV
ERLARIYRLTLENLLL
NT seq 1131 nt NT seq  +upstreamnt  +downstreamnt
atgtccaacagtaccctgacacttgcccagatgttgattgcacgtcgttcgctgacacct
gacgatgatggttgccagaaaatgatcatgcatcgtctggcagggcttgggttcaaaagc
gactccatgaccttcggcgaagtggaaaacctgtggacgagaaaaggttccgacgcacca
ctggtatgttttgccgggcataccgatgtcgtgccgaccgggccggttacacaatgggat
agcgatccttttacgccggtggttcgggatggctttctctacgggcgcggtgcggcggat
atgaaaacctccttggctgccttcgttactgcgatcgaggagtttattgagctgcatccc
gatcacaaaggctcgattgcgctgctgatcacctcggatgaagaagggccggcagtggat
ggtacggtaaaagtcgtggaagcactgcagacgcgcggggaaatgatcgattattgcatc
gtgggcgagcccacctgcaccaaccagttgggcgataccatcaaaaacggccgacgtggc
agtttgtcaggtaatctgactgtcagaggcatccaggggcatattgcgtatccccatctg
gccagaaatcctatccatacggccgcaccggccattgccgagcttgcgcaaaccgtgtgg
gacaatggtaacgagtatttccccgccaccacctggcacatttccaacattcatggcggt
accggcgcaaccaacgtcattcccggcgaaatcaacctgctgttcaatttccgtttctcc
accgccagcacggtcgattcactcaaagcacgggtacatgaaattctcgatcggcacgga
ctggattatgaactgatctgggaactctccggtaaaccttaccttaccccgagaggaacc
ctggccgacgcagtcagtgcggccattcgcgaggtaacgggtatcgagccggaactttct
accaccggtggcacttccgatggccgtttcatcgctgatatatgtcagcaggtggtggaa
ttcgggccgcgcaacgcaaccatccacaaaatcaatgaatctgtggaagttgcagatgtc
gaacgcctggcccgaatttatcgcttgacgctggaaaacctgctgctttga

DBGET integrated database retrieval system