KEGG   Nitrosomonas europaea: NE0212Help
Entry
NE0212            CDS       T00130                                 

Gene name
ruvA
Definition
Holliday junction DNA helicase RuvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
neu  Nitrosomonas europaea
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:neu00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    NE0212 (ruvA)
Enzymes [BR:neu01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     NE0212 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
247313..247900
Genome map
AA seq 195 aa AA seqDB search
MIGRIAGLLLEKHPPLVLVDVNGIGYEIDVPMSTFCRLPGIGEQVTLHTHFWVREDAHLL
FGFMTEPERVLFRQLTKISGIGARTGLAILSGLSVNDLHQIVVSQDSTRLTRIPGIGKKT
AERLLLELRDKISPAITLPETGTAMASSTDKDILNALSALGYNDREANWAVGQLSEGVTV
SDGIMQSLRLLSKAK
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgggagaattgccggcctgctgctggagaaacatcccccgcttgtactagtggat
gtaaatggcattggttatgaaatcgatgtgccgatgagcaccttctgcaggttgcccggt
attggcgaacaggtaacgcttcacacccatttctgggtgcgtgaggatgcacatttgttg
tttggttttatgacggagccagaacgggtactgtttcgtcagcttacaaaaatctccggt
attggtgcaagaacaggtttggcgatcttatctggtttgagtgtcaatgacttgcatcag
atcgtggtatcacaggacagcacccgtctgaccagaatcccgggtatcggaaaaaaaact
gcggagcgtttgctgcttgagttgcgcgataaaatcagcccggcgataaccctgcctgaa
actggaacagcgatggcctcaagtaccgataaagacattctcaacgcgctatctgcactg
ggctataatgaccgcgaagccaactgggcagttggacagctatcagaaggtgtgacggta
tctgacggcatcatgcagtcactcaggcttttatcgaaagcaaaataa

DBGET integrated database retrieval system