KEGG   Nitrosomonas europaea: NE0360Help
Entry
NE0360            CDS       T00130                                 

Gene name
aceF
Definition
(GenBank) aceF; dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase complex (e2) protein
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
neu  Nitrosomonas europaea
Pathway
neu00010  Glycolysis / Gluconeogenesis
neu00020  Citrate cycle (TCA cycle)
neu00620  Pyruvate metabolism
neu01100  Metabolic pathways
neu01110  Biosynthesis of secondary metabolites
neu01120  Microbial metabolism in diverse environments
neu01130  Biosynthesis of antibiotics
neu01200  Carbon metabolism
Module
neu_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NE0360 (aceF)
   00020 Citrate cycle (TCA cycle)
    NE0360 (aceF)
   00620 Pyruvate metabolism
    NE0360 (aceF)
Enzymes [BR:neu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     NE0360 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H CAT Transferase HlyD_D23 Senescence_reg
Motif
Other DBs
NCBI-ProteinID: CAD84271
JGI: NE0360
UniProt: Q820A3
Position
complement(401482..402843)
Genome map
AA seq 453 aa AA seqDB search
MQVAEVKKVLVPDIGDFEDIPVIEIMVKPGDSVQVEDPLIVLESDKATVEVPSPYSGIIR
EIRVQMGSKVSKDSEILTMEVVSAESDNKTTSSQPQPSAGSQPAQPTRPIETGAGQSEEE
PAAKPAATTTKPATPSAPIQIPDHTIDQHNKIIPHASPSVRRFARELGVDLSKVVGTGPK
QRILKEDVQAFVKQALTGGRNARGGTLDLLPWPHVDFAKFGPIELKSLSRIREISGANLH
RNWVMIPHVTQFDEADVTDLEALRKNHNETRQNNGTKLTILAFLIKAVTAALKKFPEFNA
SLDNSTTESQLIIKRYYHLGFAADTPNGLVVPVIRDADQKGVIGIAEELTRLSSLAREGK
LKPGDMQGASFTISSLGGIGGTGFTPIINAPEVAILGVSRASLKPVYQNGQFVPRLVLPL
SLSYDHRVIDGASAARFTAHLASILADMRLALF
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
gtgcaagtggctgaagtcaagaaagttctggtcccggatatcggggattttgaagatatt
ccggtcattgaaatcatggtcaagcctggcgacagtgtgcaggtcgaggaccctttgatc
gtactggaatcggacaaagccactgtcgaggttccttcaccttattccgggatcatccgg
gaaatcagggtgcaaatgggcagcaaagtctccaaagactcggagatcctgaccatggaa
gtggtctctgcagaaagcgacaataaaacaacttcctcccagccacaaccatcagccgga
tcacagcctgcacaaccaacccggccgatcgaaacaggagccggtcaatccgaagaggag
ccggcagccaaacctgctgctacgacaacgaagccggccaccccctctgctcccatacaa
ataccggatcatacgatcgaccagcacaataagataattccccatgcaagcccttcggtc
agacgatttgcccgcgagctgggagtggatctgagcaaggtagtgggaaccggccccaag
cagcgcattctcaaagaagacgtacaagctttcgttaaacaagctctgacgggtggacgt
aatgccaggggaggcacactcgatttattaccgtggccacatgtggattttgccaaattc
gggccgatcgaactgaaatcgctgtcgcgtatccgggagatctcaggtgccaatctgcat
cgcaactgggtcatgattccgcatgtcacgcagttcgatgaagcagacgtcaccgatctg
gaagcgctcagaaaaaaccataatgaaacccggcaaaacaatggcactaaactgaccata
ctggctttcctcatcaaagcagtcacagcagcgctgaaaaaatttccggagttcaacgcc
tctctggataacagcaccacggaaagccagctcatcatcaagcgctactaccacctgggt
ttcgcggccgatacccccaacgggttagtggttcccgtcatccgcgatgccgatcagaaa
ggagtaatcggtatcgccgaggagcttaccagactgtcctcacttgctcgtgaaggcaaa
ttgaaaccgggcgacatgcagggcgcaagttttaccatttccagcctgggtgggatcggt
ggaacaggcttcacccccattatcaacgcaccagaagtagcaattctgggtgtctcgcgt
gcaagtctgaaaccggtttaccagaacgggcaatttgttccgcgcctggtgcttccgctt
tcgttatcctacgaccaccgggtcatcgacggtgcatcagccgcacgcttcactgcacat
ctggccagtattctggcggatatgcgtcttgccctgttctga

DBGET integrated database retrieval system