KEGG   Nitrosomonas europaea: NE0442Help
Entry
NE0442            CDS       T00130                                 

Gene name
holC
Definition
DNA polymerase III subunit chi (EC:2.7.7.7)
Orthology
K02339  
DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
neu  Nitrosomonas europaea
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    NE0442 (holC)
   00240 Pyrimidine metabolism
    NE0442 (holC)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    NE0442 (holC)
   03430 Mismatch repair
    NE0442 (holC)
   03440 Homologous recombination
    NE0442 (holC)
Enzymes [BR:neu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     NE0442 (holC)
DNA replication proteins [BR:neu03032]
 Prokaryotic Type
  DNA Replication Elongation factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     NE0442 (holC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
481428..481817
Genome map
AA seq 129 aa AA seqDB search
MLIACRLCAKAVQQGLKTVVYVPDERLAGQFDKLLWTFTPTGFVPHCRVDNKLADVTPVI
MNSRPVLMEAGCFGVLLNLDADVPPGFEQFPRVVEIVDEAEDGKLQARKRYRHYQEQGHD
VRHHRLDGN
NT seq 390 nt NT seq  +upstreamnt  +downstreamnt
ttgctgatagcctgtcgcctgtgtgcaaaagcggtgcagcaggggttgaaaaccgtcgtc
tatgttccggatgagcgtctggcaggccagtttgataagttactctggacgtttacaccc
accggcttcgtgccgcattgccgggtggataacaagctggcagatgtgacgcccgtaata
atgaacagtcggcccgtattgatggaagccggctgttttggtgtattactcaatctggat
gcggatgttccgccaggatttgaacagtttccacgcgtggtggaaattgttgatgaagca
gaggatggtaaactgcaggcgcgcaaacgttaccggcactaccaggaacagggacacgat
gttcgccatcaccggctcgatggaaattga

DBGET integrated database retrieval system