KEGG   Nitrosomonas europaea: NE0516Help
Entry
NE0516            CDS       T00130                                 

Definition
hypothetical protein (EC:5.3.4.1)
Orthology
K01829  
protein disulfide-isomerase [EC:5.3.4.1]
Organism
neu  Nitrosomonas europaea
Brite
Enzymes [BR:neu01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     NE0516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
554896..555660
Genome map
AA seq 254 aa AA seqDB search
MKLAKLLLTLVLASFACLTVANPMWEPDLPRAKSAFEKETRVPLRAGHYIEPTLFKGFYA
VRTGQAGGPSAYFREDMGWLGNIKSPGWVIQSPAEDNPAYKHTWLRQQLAQIPLEQLVLV
KRSTPPVAVIWSAPDCPYCRKLEKTLEQENASVYVVPVGVAENGFRQAARVYCADDPSQA
WRKVMQGSEINGRAKTSCQYPRDMLNDIGFFLGMGRMATPIVVFADGSTVIGWNDQNAWM
LLRKKISEQIFFND
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgaagcttgcaaaattattacttactttagttttagcatctttcgcctgcctgacggtg
gcgaatccaatgtgggaaccggatttacccagggcaaagtctgcgtttgaaaaggaaacg
agagttcccttacgggcaggtcattatatcgagcccactcttttcaaaggattttatgcc
gtgcgcacggggcaggcaggtggcccttctgcctatttccgggaggacatgggatggttg
gggaatataaagtcgccagggtgggtaattcagtcaccagctgaagataacccggcctat
aaacatacctggctgcgtcaacagcttgcacagattccattggaacagttggtgctggta
aaacgatctactccacctgtggcagtgatatggtcggcgccagattgtccttattgccgc
aaacttgaaaaaacactggagcaggaaaatgcttccgtatatgtggtaccggtgggggtg
gctgaaaatggattcaggcaggctgccagggtatattgtgctgatgatccttcacaagcc
tggcgcaaagtgatgcaaggttctgaaataaatggtcgagcgaaaacttcatgccaatat
cctcgtgatatgttaaacgacatcggcttctttcttggaatgggaagaatggcaacgcca
atcgttgtttttgccgatgggtctacggtaattgggtggaatgatcagaatgcctggatg
ctcttgcgcaaaaaaataagtgagcaaattttttttaacgattaa

DBGET integrated database retrieval system