KEGG   Nitrosomonas europaea: NE0620Help
Entry
NE0620            CDS       T00130                                 

Definition
(GenBank) Iron-containing alcohol dehydrogenase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
neu  Nitrosomonas europaea
Pathway
neu00010  Glycolysis / Gluconeogenesis
neu00071  Fatty acid degradation
neu00350  Tyrosine metabolism
neu00625  Chloroalkane and chloroalkene degradation
neu00626  Naphthalene degradation
neu01100  Metabolic pathways
neu01110  Biosynthesis of secondary metabolites
neu01120  Microbial metabolism in diverse environments
neu01130  Biosynthesis of antibiotics
neu01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    NE0620
  Lipid metabolism
   00071 Fatty acid degradation
    NE0620
  Amino acid metabolism
   00350 Tyrosine metabolism
    NE0620
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    NE0620
   00626 Naphthalene degradation
    NE0620
Enzymes [BR:neu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     NE0620
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: CAD84531
JGI: NE0620
UniProt: Q82WP4
Position
complement(675883..677067)
Genome map
AA seq 394 aa AA seqDB search
MMPFSIARLPRIEFGAGVLKKLPDIIESYGNHILLVTGAHSFMNTPYWRLLIDQFEHRAI
TWRHAMVAEEPSPALIDDFVIDYANEHFAAVIGIGGGSVLDTAKAVAGLLQVQHSVMDYL
EGVGPELSYQGPAVPFIAVPTTAGTGSEATKNAVLSVQGENGFKKSFRHDKLVAEYAIVD
PDLLASCPPGVIAANGMDALTQLLESYVSLKANALTDALAISGLQAVRDALLPFYHQQGE
LAQHREKMAYAALLSGITLAQTGLGSVHGLASPLGAFYPIPHGVVCGTLVAAATRINLHS
MHMREPDNPALAKYRHVAEILCKQHFNDPEIAFDALIDLLTQWTEELTLPRLSHYGLQPA
GLDKVIAHCRGSSMKTNPIVLTDDEIRQILLERL
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgatgcccttttctattgcccggctgccgcgcatcgaatttggtgcaggggttctgaaa
aaactgccggatatcatcgaaagttatggcaaccatattttgctggttaccggcgcgcac
tcctttatgaatactccctactggcggcttctgatcgatcagtttgagcatcgcgccatc
acctggcgacatgccatggtagcggaagagccttctcctgctttgatcgatgacttcgtc
atagattatgccaatgaacactttgctgcagtcattggcatcggaggtggcagcgtactc
gatactgccaaagccgtagccgggttgctgcaagtacaacattcagtaatggattacctc
gaaggagttggcccggagctgtcgtatcaggggccagccgtaccattcatcgctgtcccc
acgaccgccggcactggcagtgaggcaaccaaaaacgccgtactcagcgtgcaaggtgag
aatggtttcaagaaatccttccgtcacgacaaactggttgctgaatatgcaatcgtcgat
ccggatttactggccagttgcccgcccggcgtcatcgctgccaacggtatggatgcgctg
acacaattgctggaatcgtacgtatccctcaaagccaatgccctcaccgatgcactggcg
atcagtggattgcaagctgttcgtgacgcactgctcccgttttatcaccagcaaggcgag
ctggcgcaacaccgggagaaaatggcttacgctgcactgctctccggtatcacgctggcg
caaacagggttgggttcggtgcatggcctggcatccccgctcggtgcgttctacccgatt
ccgcatggtgtcgtttgcggtaccctggttgcagccgccacccggatcaaccttcacagc
atgcacatgcgtgagccggataatccggcattggcaaaataccggcatgttgctgagatt
ttgtgcaagcagcactttaacgatccggaaatcgcctttgatgccctgatcgatctgttg
acgcaatggacagaagaactcaccctgccccggctgtcacactacggtctgcaacctgcc
gggctcgataaagtcatcgcccactgccgtggcagcagcatgaaaaccaatccgatcgtg
ctcactgatgatgagattcggcaaattctgctggaaagactgtaa

DBGET integrated database retrieval system