KEGG   Nitrosomonas europaea: NE0693Help
Entry
NE0693            CDS       T00130                                 

Gene name
trpB
Definition
(GenBank) Tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
neu  Nitrosomonas europaea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NE0693 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NE0693 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NE0693 (trpB)
Enzymes [BR:neu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NE0693 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
752734..753927
Genome map
AA seq 397 aa AA seqDB search
MYDLPDKRGHFGPYGGTFVAETLISALDELCKQYEYYRDDAEFQAEFFHELKHYVGRPSP
IYHAKRWSEHLGGAQILLKREDLNHTGAHKVNNTVGQALLARRMGKGRIIAETGAGQHGV
ASATVAARYGMECVVYMGSEDVKRQATNVYRMKLLGATVIPVDSGSCTLKDALNEAMRDW
VTNVSNTYYIIGTVAGPHPYPMMVRDFQAIIGNEARQQMREEYGRQPDALIACVGGGSNA
IGLFYPYIDEENVRMIGVEAAGKGIDTHEHAATLVTGRPGVLHGNRTYLIQDENGQIIET
HSISAGLDYPGVGPEHAWLKDCGRAEYVAVTDDEALAAFHALCRFEGIIPALESSHALAY
AAKLAPTLNKDQLLLVNLSGRGDKDMATVAQQSGISL
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgtacgatcttcctgataaacgtggccattttggcccgtatggcggtacattcgtggct
gaaaccctgatttccgccctggatgagctgtgtaagcagtatgaatactatcgtgatgat
gccgaatttcaggcagagttttttcatgagctcaagcactatgtaggtcgccccagtccc
atttaccacgccaaacgctggtcagaacatctggggggcgcacaaatcctgctgaaacgt
gaagacctcaatcacacaggcgcacacaaggtaaacaataccgtgggtcaggctttgctt
gcaaggcgaatgggaaaaggtcgcatcatcgctgaaacgggtgctggtcagcatggggtg
gccagtgctaccgttgctgcccggtacggaatggaatgtgtcgtatacatgggttccgag
gatgtcaaacgacaggccaccaacgtttatcgtatgaagttgctcggagccacggtcatt
ccggtcgattcaggttcgtgcacactcaaggacgcattgaatgaagccatgcgtgactgg
gttaccaacgtaagtaacacttactacatcattggaacggtggcagggccacatccttat
ccaatgatggtcagagattttcaggcaattatcgggaatgaggccaggcaacagatgcgg
gaagagtatggcagacagccggatgctctgatcgcatgcgtgggagggggatccaacgcc
attggcctgttctatccttatattgatgaagaaaatgtccggatgatcggtgtggaagct
gccggcaaagggatcgatacacacgagcacgcagccacgctggtgacgggcagaccgggt
gtgctgcatggtaatcgtacttatctgatacaagatgagaacggtcagatcatcgagaca
cattcaatttctgccggcctggattatccgggtgtaggaccggagcatgcatggctcaag
gattgtggccgtgccgagtatgtggctgtgacggatgatgaagcactggctgcatttcat
gcactttgccggttcgagggcatcattcctgctctggaatccagccatgccctggcttat
gcagccaaactcgcaccaacgctcaataaagaccagttgcttctggtcaatctgtccggc
cgtggagacaaggatatggcaacggtagcgcagcagtcgggcatttcgctctaa

DBGET integrated database retrieval system