KEGG   Nitrosomonas europaea: NE0694Help
Entry
NE0694            CDS       T00130                                 

Gene name
trpA
Definition
(GenBank) trpA; tryptophan synthase (alpha chain) protein (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
neu  Nitrosomonas europaea
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    NE0694 (trpA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    NE0694 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    NE0694 (trpA)
Enzymes [BR:neu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     NE0694 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
753980..754807
Genome map
AA seq 275 aa AA seqDB search
MNRIQSVFSQLKSQNRAALIPFITAGDPDATTTVALMHRLTQAGVDLIELGVPFSDPMAD
GPTIQRSSERALKHHISLKDVFSMVAEFRKTNQSTPVVLMGYANPIEAMGYKDFVQTAGH
AGVDGVLVVDYPPEECTEWVRYLKEQNIDPIFLLSPTTPESRIRRVAELARGYVYYVSLK
GVTGASHLDLHEVGDKLSQLRSYINIPIGVGFGIRDEQTARRIAEQADAVVIGSRIVEEI
EHSPAADLLANVGALVESLRRAIDAKSDHSSITEK
NT seq 828 nt NT seq  +upstreamnt  +downstreamnt
atgaatcgtatccaatctgtcttttcccagctcaaatcacagaatagagctgcgctcatt
cccttcatcacggcgggtgatcctgacgcaactacgacagtggcgttgatgcaccggttg
acgcaggccggagtggatctgatcgaactgggagtcccgttttctgatcccatggcggac
gggccaaccatacagcgctcttcagagcgtgcattgaaacatcacatcagtctgaaagat
gtattttccatggtggccgagttcagaaaaaccaatcagagtacaccggtggtcctcatg
ggatatgccaacccgatcgaggccatgggctataaagattttgtgcaaacagccggccat
gccggagtcgatggtgttctggtcgtcgattatccgccggaagaatgtactgaatgggtg
cgctatttgaaagagcagaacatcgatccgatttttctgttatctcccacgacacctgag
tcacgcatcaggcgggttgcggagcttgccagagggtacgtctattatgtttctctgaag
ggagttacgggcgcttcacatcttgatttgcatgaggttggcgacaaactgtcgcagctt
cgttcgtacatcaacattccgattggagtaggtttcggtatacgagatgaacaaacggca
cggcgtattgcagaacaggctgatgcggtagtcataggcagccgcatcgtggaagaaatc
gaacactctccagcggcggatctgctggcgaatgtgggagccctggtagagtctttgcgg
cgtgcaatcgacgcaaaatccgatcattcttctattacggagaagtga

DBGET integrated database retrieval system