KEGG   Nitrosomonas europaea: NE0872Help
Entry
NE0872            CDS       T00130                                 

Gene name
hisD
Definition
(GenBank) Histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
neu  Nitrosomonas europaea
Pathway
neu00340  Histidine metabolism
neu01100  Metabolic pathways
neu01110  Biosynthesis of secondary metabolites
neu01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:neu00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    NE0872 (hisD)
Enzymes [BR:neu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     NE0872 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: CAD84783
JGI: NE0872
UniProt: Q82W26
Position
950645..951943
Genome map
AA seq 432 aa AA seqDB search
MIKIRRLSSVDDHFQAELDQLLSFEVSVDSEIERTVTQILHQIRTHGDRALLELTRQFDN
PDIDRIEEIELPRDEWQSALMSLDKVQREALEQAASRIRAYHEKQLAQSWDYVELDGTRL
GQKITALDRVGLYVPGGKAAYPSSVLMNAIPARVAGVRELIMVTPTPKGEKNPLVLAAAA
ICEVDRVFTIGGAQAVAALAYGTTTVPKVDKIVGPGNAYVAAAKRHVFGTVGIDMLAGPS
EILVICDGKTNPDWIAMDLFSQAEHDEQAQSILLCPDKAFLDRVADSISRLIDTLPRRDV
IRSSLENRGALIHVRDLEEACMIANRIAPEHLELSVDEPEQWVDSIRHAGAIFLGRYTCE
ALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRTSLIQVSAAGASRLGETASILAKGEGL
DAHARSAESRYQ
NT seq 1299 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaataaggcgattgtcatccgttgatgaccatttccaggcagaactcgaccaa
ttgttgagttttgaagtttctgtcgatagcgagatcgaacgcaccgtcactcaaatcctg
catcagatcagaacacatggggacagagcgttactcgagcttacacgccagtttgataat
ccggatattgaccggatcgaagaaatcgaactgccccgggatgagtggcaatctgctttg
atgtcgttggataaggtacaacgtgaggcgttggagcaagctgcttcccgtatacgagcc
tatcatgaaaaacagttggcccaatcatgggattacgttgagctggatggcacgcgactg
gggcagaaaatcaccgcactggaccgggtcgggctctatgtacctggaggtaaggctgcc
tatccttcatctgtactgatgaatgcaattcctgcccgggtagcgggtgtcagggaattg
atcatggtaacgccaacgccaaaaggagaaaaaaatccactggtgctggccgctgccgca
atctgtgaagtagatcgtgtttttaccattggaggtgcacaggcagtcgccgcgctggct
tatggcacaaccaccgtcccaaaggtggataaaatcgtcggacctggtaatgcttatgtg
gccgcagcaaaacgacatgtctttggtacagtcggaattgatatgctggcagggccatcc
gaaattctggtgatctgtgatggaaaaaccaatcctgactggattgcaatggatctgttc
tcacaagcggagcacgatgaacaggcacaatcgatcctgctttgcccggataaagcattc
ctggatcgggtagcagacagtatttcccgcctgatcgatacattgccacgccgagatgta
attcgttcttcgctggagaaccgcggtgctttgattcatgtgcgtgatctggaagaagcc
tgcatgattgccaaccggatcgcccccgaacatctggagctgtccgttgatgagccggag
caatgggtggatagcatccggcatgccggcgcaatttttcttggacgatatacttgtgaa
gcactgggagactattgtgcagggcccaatcatgtccttcccacctccggtacggcacgc
ttttcctcaccactgggagtttacgattttcagaaacgtaccagcctgattcaggtctca
gcagccggagcatccaggttgggtgaaacggcatccattctggcaaagggagaaggtctg
gatgcccatgccagatcagctgaatcccgttatcagtaa

DBGET integrated database retrieval system