KEGG   Nitrosomonas europaea: NE0949Help
Entry
NE0949            CDS       T00130                                 

Definition
(GenBank) pimt: protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
neu  Nitrosomonas europaea
Brite
Enzymes [BR:neu01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     NE0949
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_25 Methyltransf_31 RrnaAD NodS Methyltransf_11 Methyltransf_23
Motif
Other DBs
NCBI-ProteinID: CAD84860
JGI: NE0949
UniProt: Q82VW0
Position
complement(1034799..1035467)
Genome map
AA seq 222 aa AA seqDB search
MSVRHSGIGMTSLRTRVRMVERLREQGIKDEVVLAAMGFIPRHLFVEAALASRAYEDVAL
PINYGQTISSPWIVGRMTELLRNGGSNSLRKILEIGTGCGYQTAVLAKIASEVYSIERIG
PLLTRTRIRLRELGILNIHLKHADGMRGLPEAGLFDGIMMTAVIPEIPETLLEQLAMGGR
MVFPKGNRKQYLCVIDHTTEGFVETILDEVMFVPILPGTINR
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgtacgccattctggtatcggcatgacatcgctgcggacgcgggttcgtatggtc
gaacgcttgcgggaacagggtattaaagatgaagtggtattggcagcaatgggttttatc
ccgcgccatctttttgttgaggcagccttggcatctcgggcatatgaagatgttgcgtta
ccgatcaattacggacaaaccatctccagtccctggattgtcggccgtatgactgaattg
ctgcgaaatggtggcagtaattcacttagaaaaatcctggaaattggtacagggtgtggt
tatcagactgcagttctggcaaaaatagcaagtgaagtctactcgattgagcggataggt
cctttgttgacacgtacacgtattcgattacgtgaattgggtattctcaatattcatctg
aagcatgctgatggtatgcggggcttaccggaagcagggctgttcgatggaattatgatg
acagcagttataccggaaataccggagacacttctggaacaattggctatgggtggcaga
atggtattcccaaagggaaacaggaagcaatatctttgtgtgatcgatcacacgaccgaa
ggttttgttgaaactatcttggatgaggtgatgtttgtaccgatacttcccggaactatc
aatagatag

DBGET integrated database retrieval system